KEGG   Thermotoga maritima MSB8: TM1195Help
Entry
TM1195            CDS       T00022                                 

Definition
(RefSeq) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TM1195
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TM1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4434 Cellulase DUF4838 Glyco_hydro_35
Motif
Other DBs
NCBI-GeneID: 898289
NCBI-ProteinID: NP_229000
UniProt: R4NSB2 Q9X0S2
LinkDB All DBs
Position
complement(1215037..1216986)
Genome map
AA seq 649 aa AA seqDB search
MLGVCYYPEHWGTEKVEEDFRRMKELGIEYVRIGEFAWSRIESERGKFNWDWLDKTLELA
EKMGLKIVLGTPTATPPKWLIDEHPEILPVDKDGRVKNFGSRRHYCFSSPVYREEVKRIV
TIIVKRYGKHPAVAGWQTDNEYGCHDTVRCYCPRCKKAFQKWLERKYEGDIKKLNEAWGT
VFWSQEYRSFDEIELPNLTPADPNPSHLLDYYRLASDQVVEFNKLQVEIIREYSPGRFIT
HNFMSGFTDFDHYKLSKDLDFATWDNYPLGHTLVFLRMKGETKNPFDRVGHPDIISFSHD
LYRGVGRGRFWVMEQQAGPVNWAPYNLWPAKGAVRLWTWQAFAHGAEVVSYFRWRQAPFA
QEQMHSGLLAPDSAPYPGYHEVKQVFEELKNIDINEPVESEVALVFDYETAWVFSIQPHG
EGVNYIDLVFRFYSALRRLGLNVDIVPPGSSLDGYKMIVVPSLAIVKEEVLDTFKKYDGL
LVLGPRSGSKTETFQIPPEMPPGLLKEIIPVEVRQVESLGDNVETLVWNGKEYPVSIWRE
DVDPTITEVIARFKDGFGAIFRKENVFYLAFWPNGDFLVDFFEALSKESGIETKRMPEGV
RIQRRGEYVFSFNFTSEEVDLEIPTKVQIVLGDQKIPPYGLLIWKENER
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgtctgttactatccagaacactggggaacagagaaagttgaagaagacttc
agaaggatgaaagaactcgggatagagtacgtgaggattggagagttcgcctggagcagg
atagagtcggagcgtggaaagttcaactgggactggctcgacaaaacacttgagctggca
gagaagatggggctcaagatcgtactgggaactcccacagccacacctccgaagtggctc
atcgatgaacacccggagatccttcccgttgataaagatggcagggtgaaaaattttggt
tccagaagacattattgcttctccagccctgtttatagagaggaagtgaaaagaatcgtc
accataatagtgaaaagatacggaaaacacccggcagtcgcaggctggcagacggacaac
gagtacggctgtcacgatacggtgaggtgctactgtccgaggtgcaaaaaagccttccaa
aaatggctggaaagaaagtacgagggagacataaagaaattgaatgaagcgtggggaaca
gtgttctggagccaggagtatcgatccttcgacgaaatagagcttccgaatctcacccct
gccgacccgaacccgtcgcatcttctcgactactacaggttagcctccgaccaagtggtg
gaattcaacaagctccaggtggagataataagggagtattcgccgggaagattcatcaca
cacaatttcatgtccggtttcacagattttgatcattacaaactctcgaaagacctggat
ttcgcaacctgggacaattacccgctcggacacaccctcgtttttctgagaatgaagggt
gagacaaaaaatccgttcgacagagtgggacacccggacatcatctcattctcgcacgat
ctgtaccggggagtgggcagaggaagattctgggtgatggaacagcaagcaggacctgtg
aactgggctccttacaatctctggcccgccaagggagcggtgagactctggacgtggcag
gcgttcgcacacggtgcggaggtggtctcctacttcagatggagacaggcaccttttgcg
caggagcagatgcactctggacttctggcaccggattcagcaccttaccctggataccac
gaggtaaagcaggttttcgaggagctcaaaaacatcgatatcaatgagcccgtggaaagc
gaagtggcacttgtcttcgattatgaaacggcgtgggtcttctccatacaaccgcacggc
gagggggtgaactacatcgatcttgtcttcagattctacagtgccctcagaagactcggt
ctgaacgtggatatagtaccccctggatcttcactggacggatacaaaatgatcgttgtt
ccaagccttgccatcgtgaaggaggaggttctggacacgttcaaaaaatacgacggtctt
ctcgtacttggcccaagaagcggaagcaaaacagagacattccagataccaccagaaatg
cccccaggtcttctcaaggagatcatacccgttgaagtgagacaggttgaaagccttgga
gataatgttgagacacttgtttggaacggtaaggaataccctgtctcgatatggagagag
gatgtggaccccaccatcacggaagtgatcgcaagattcaaagatggttttggagccatc
tttcgaaaggaaaacgtcttctaccttgctttctggccgaatggagactttctcgtagat
ttctttgaagcactttcaaaagaatcaggaattgaaacgaaaaggatgccagaaggagta
cgcattcaaaggagaggtgaatatgttttttctttcaatttcacctctgaggaggtagat
ttagaaataccaacgaaagttcagatagttctaggagatcaaaagattcctccctatgga
ctgctgatatggaaggaaaacgaacgctga

DBGET integrated database retrieval system