KEGG   Thermotoga maritima MSB8: TM1502Help
Entry
TM1502            CDS       T00022                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
tma  Thermotoga maritima MSB8
Brite
Translation factors [BR:tma03012]
 Eukaryotic Type
  Elongation factors
   TM1502 (tuf)
 Prokaryotic Type
   TM1502 (tuf)
Mitochondrial biogenesis [BR:tma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TM1502 (tuf)
Exosome [BR:tma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TM1502 (tuf)
  Exosomal proteins of breast cancer cells
   TM1502 (tuf)
  Exosomal proteins of colorectal cancer cells
   TM1502 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1498842..1500044)
Genome map
AA seq 400 aa AA seqDB search
MAKEKFVRTKPHVNVGTIGHIDHGKSTLTAAITKYLSLKGLAQYIPYDQIDKAPEEKARG
ITINITHVEYETEKRHYAHIDCPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHV
LLARQVEVPYMIVFINKTDMVDDPELIDLVEMEVRDLLSQYGYPGDEVPVIRGSALKAVE
APNDPNHEAYKPIQELLDAMDNYIPDPQRDVDKPFLMPIEDVFSITGRGTVVTGRIERGR
IRPGDEVEIIGLSYEIKKTVVTSVEMFRKELDEGIAGDNVGCLLRGIDKDEVERGQVLAA
PGSIKPHKRFKAQIYVLKKEEGGRHTPFTKGYKPQFYIRTADVTGEIVGLPEGVEMVMPG
DHVEMEIELIYPVAIEKGQRFAVREGGRTVGAGVVTEVIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaatttgtgagaacaaaaccgcatgttaacgttggaacgattggacat
atcgaccacggaaaatccacactgacagccgctataacaaagtacctttctctcaaggga
cttgcccagtatattccttacgaccagatcgacaaggcccctgaagaaaaggcaagagga
atcaccatcaacatcacacacgttgagtatgagaccgaaaagagacactacgctcatatt
gactgtcccggtcacgcggactacatcaagaacatgatcacaggagcagctcagatggac
ggagccatccttgttgttgccgcaaccgatggtcccatgccccagacaagagagcacgtg
cttctcgcaagacaggttgaggttccctacatgatcgtcttcataaacaagacagacatg
gttgacgatcctgagctcatcgacctcgtcgagatggaagtgagagaccttctgagccag
tacggttaccctggagacgaagtgccagtcataagaggttctgctctgaaagccgtcgaa
gctcctaacgatccgaatcacgaagcttacaaacccatccaggagctcctcgacgctatg
gataactacattcctgatcctcagagagacgtcgataagccgttcctcatgcccatcgaa
gacgtgttctccatcacaggaagaggaacggttgttacaggaagaatagaaagaggaaga
atcagacccggtgatgaagttgagatcataggtctcagctacgagatcaagaagaccgtt
gtgacgagtgtggaaatgttcagaaaggaactcgatgaaggaatcgcaggagacaacgtt
ggatgtctgctcagaggaatcgacaaggatgaagttgaaagaggacaggttctcgcagct
cccggaagcatcaaacctcacaagaggttcaaggctcagatctacgttttgaagaaggaa
gagggaggaagacatacaccgttcacaaaaggctacaagcctcagttctacataagaacc
gctgacgttacaggagaaatcgtaggacttcctgaaggtgtcgaaatggtcatgcctgga
gaccacgtcgaaatggaaatagaactcatctaccctgtcgctatcgaaaagggacagaga
ttcgctgtaagggaaggcggaagaacagttggagctggtgtggttacagaagtcatcgag
tga

DBGET integrated database retrieval system