KEGG   Thioflavicoccus mobilis: Thimo_0239Help
Entry
Thimo_0239        CDS       T02397                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0239
   00620 Pyruvate metabolism
    Thimo_0239
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_0239
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thimo_0239
   00680 Methane metabolism
    Thimo_0239
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Thimo_0239
Enzymes [BR:tmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Thimo_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
255632..256618
Genome map
AA seq 328 aa AA seqDB search
MAKAPVRVAVTGAAGQIGYALLFRIVSGEMLGRDQPVILQLLELPLERAQRALKGVMMEL
EDCAFPLLAGVIGTSDPKVAFRDADYALLVGARPRGRGMERSDLLQENAKIFIEQGRALD
EVASRDIRVIVVGNPANTNALIAMKSASGLPRENFTSMMRLDHNRALSMLAGRAGKPVAA
VERMVVWGNHSPTMYPDIRYATIEGERASDLVDAAWYKETYIPSVAKRGAAIIEARGTSS
AASAANAAIAHMRDWALGTSGRWVTMGVVSDGSYGIPEGLVYGVPCTCEAGSWQRVEGLE
IDAFSRQMMDRTLEELLEERDGISPLLS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcacccgttcgtgtggccgtcaccggcgccgctggccagatcggttatgcg
ctgctgttccgcatcgtcagcggcgaaatgttgggcagagatcaacctgtcatcctgcaa
ttgttggaattgccgctcgagcgggcgcaacgggccctcaaaggggtcatgatggagctg
gaggattgtgccttcccgctgttggcgggcgtgatcggcacctccgatcccaaggtcgcc
ttccgcgacgccgactatgccctgctggtcggtgcgcggccgcgcggccgtggcatggaa
cgcagcgacctgttgcaggagaacgccaagatcttcatcgagcagggccgtgccctggac
gaggtcgcctcgcgcgatatccgcgtcatcgtggtcggcaatcccgccaacaccaatgcc
ctgatcgccatgaagagtgcctcggggttgccgcgggagaacttcacttcgatgatgcgc
ctcgaccacaaccgcgccctctccatgctcgccggtcgcgccggcaagccggtggccgcg
gtggagcgcatggtggtctggggcaaccactctccgaccatgtaccccgatatccgctac
gccaccatcgagggcgagcgtgcctccgatctggtcgatgccgcctggtacaaggagacc
tacatccccagcgtcgccaaacgcggtgccgccatcatcgaggcgcgcggcacctcgtcc
gccgcttcggccgccaatgccgccatcgcccatatgcgtgactgggcattgggaaccagc
ggtcgctgggtgaccatgggcgtggtttcggacggctcctacggcattcccgagggcctg
gtctacggcgtgccctgtacctgcgaggcgggcagctggcaacgggtcgaagggctggag
atcgacgcgttctcccgccagatgatggatcggacgctcgaggagctattggaggaacgc
gacggcattagcccactgctctcctga

DBGET integrated database retrieval system