KEGG   Tatlockia micdadei: LMI_1919Help
Entry
LMI_1919          CDS       T03810                                 

Definition
(GenBank) putative acetyltransferase
Organism
tmc  Tatlockia micdadei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(1996642..1999455)
Genome map
AA seq 937 aa AA seqDB search
MDSEKKHPQIEQGLLALVNQFLKDLDAERALKNISLEASLGRDLGIDSVGKVELFTRIEK
TFSLRLPERAIAEIDSLKELAKVIEESLKALPKRKIQSFSPIIGITDLDLSSAKTLVDVM
QTYGTKEENRPHLYLQNEQGEEQIIQYGQLLKEAKKVARGLHNKGIKQGEAIAIMLPTSD
AFFYAFAGILLIGAVPVPIYPPFRADRIEEYAEREAKILHNAQARILITFAKAETLSHIL
RTFVPSLKEVATIENLRMVTGPVPEVEPGPQDPILIQYTSGSTGDPKGVFLSHQNMLANI
RAIGKGIPVQPTDVGVSWLPLYHDMGLMNWLGAMYFGIPMVILSPLTFLTRPEQWLWTIH
YHRATLSGAPNFAYELCIKKIDDEDIQGLDLSSWRFAFNGAEAINPRTLDRFGKKFSPYG
FHIESFAPVYGLAESTVGLTFPPKRREPRIDKIQREAFEMKNKAIPTLKSKDFIEFVSCG
VPLPDHEVRIVDEAGSHVEERVIGMIQFKGPSAMKGYFNNPNATQKIYHDGWWDTDDLGY
LADKELFITGRKKDLIIKAGRNLYPEEIEEVVSEVPHVRKGCVIAFGVSDPVLGTEKLII
VAESYALEKEKQKTICAEITEKMMTALEIAPDVIFLVPPKTVPKTSSGKLRRSACKQAYL
QGKLIKKHKSITWQLVKLFSKSIYRTIRNGFFYLGKLAYTIYFVLILFVVLIPVWFGVLL
FPRTIAAKITRIGARSVFKLGLCPIHLEGEANLKSEAPMIFIANHASYSDALVLTALLPP
GTLFTAKNELLKTPVIRTFIKKLGHLVIDRMDFVKSVENKNQIEEAILKKNSVIFFPEGT
FTYATGLRPFKLGAFTVAVETKTALCPIAISGTRTFLRADSYLLTPGSIRIVIGKPLYPK
EDGGWDEIIMLHNRARLEIAKYCGEPIIDLIVAGFEG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgagaagaagcacccacaaattgaacaaggcttacttgcccttgtgaaccaa
tttttaaaagatcttgatgctgagcgtgcgttaaaaaacatctctctagaggcttcatta
ggacgtgatttagggattgatagtgtgggtaaagttgaacttttcactcgcatagagaaa
acattttcattgcgtttgcctgaacgtgcaatagcggagattgactcgctaaaagagtta
gccaaagtgattgaagaaagcttaaaagcgctgccaaaaagaaagattcaatcattctcc
ccaattatcggcattactgatcttgatctttcctcggcaaaaaccttagtagacgtgatg
caaacctatgggacaaaagaagaaaatcgacctcatttgtacttacaaaacgaacaaggc
gaagagcaaattatccagtatgggcagttattaaaggaagccaaaaaggtagctcgagga
ttgcataacaaaggaataaagcaaggtgaagcaatagcaattatgcttcctaccagcgat
gcttttttttatgcatttgctggtatattgttgattggagctgtcccggtgcctatttat
cctccatttcgagctgatcgaatcgaagaatacgcagagcgggaggcaaaaatcttacat
aatgcccaagccagaatactaattaccttcgcaaaagctgaaactctaagccatatttta
aggacttttgtccccagcttaaaagaagtggcgacaatagaaaatctgaggatggtaaca
ggtccggtacccgaggttgaacctgggccgcaagatcctattttgattcaatatacatca
ggaagtacgggggatccaaaaggggttttcctctcccaccaaaacatgcttgccaatatc
cgcgccattggcaagggaatacccgttcagcctacagatgtcggggtaagttggttgcct
ctctaccatgatatggggttaatgaattggttaggtgcaatgtactttggcattcctatg
gttattttatccccgcttacttttctaacaagaccggagcaatggctgtggacaattcat
taccatcgcgccacattatcaggagcgcctaattttgcctatgagttatgcataaaaaag
attgatgatgaggatattcaaggacttgatctcagttcatggcgattcgcattcaatggt
gctgaagcaataaatccaaggactctagaccgttttggtaaaaaattctccccttatggt
tttcatatcgaatcatttgccccagtttatggattagcagaatcgacagttggcctgaca
tttccgccaaaaagacgtgagccgcgaatcgataaaattcagagagaagcatttgagatg
aaaaataaagctattccaacattaaaaagtaaagattttattgaatttgtgagttgcggg
gttcccttacctgatcacgaagtgcgtatagtcgatgaggctggaagtcatgtggaagaa
agagtgattggaatgattcaatttaaggggccgtcagcaatgaagggttattttaataac
cctaacgcgactcaaaaaatttatcatgatggatggtgggataccgacgatctaggttat
ttggctgataaagagttatttattactggtagaaaaaaagatttgattatcaaggcgggg
cgtaatctttacccagaagaaatcgaagaagtcgtaagcgaggtaccgcacgtgcgcaaa
ggatgtgtgattgcttttggtgtaagtgatcccgttcttggtacagaaaagttaattatc
gttgctgaatcttatgctcttgaaaaagaaaagcaaaaaaccatctgtgctgaaatcact
gaaaaaatgatgacagcgctagaaattgcgcctgatgtgatattcttggtgcctccaaaa
acggttccgaaaacatctagtggaaaattacgccgttctgcatgcaagcaggcctacctc
caaggcaaactgattaaaaagcataaatcaataacctggcagttagtgaaattattttca
aaaagtatttatagaacgattcgaaacggttttttttatctaggaaaattagcctataca
atttattttgtcctcattttatttgtagtgcttataccagtttggtttggtgtgttgtta
ttcccccgaacgatcgctgcgaaaataactcgtattggtgcccgttctgtgttcaagttg
ggactttgtccaatccatcttgaaggggaggcgaacctcaaaagtgaggcaccgatgatt
tttattgccaatcatgcaagctattcagacgcattagtactgaccgctctactaccacct
ggaactcttttcacggcaaaaaatgaattactaaaaacaccggtaatacgtacgtttatt
aaaaaattaggacatttagtcattgaccgtatggattttgtaaaaagcgttgagaataaa
aatcagattgaagaagcaatcctaaagaaaaattctgtgattttttttccagagggaaca
tttacttatgcaacagggttacgcccatttaaattaggggcttttacagttgctgtggaa
acaaaaacggctttatgccccatagctatctctggtactcgaacttttttacgtgctgat
agttatctgcttacgcctggatcgattaggatagtcataggaaaaccactttatccaaaa
gaagatgggggttgggatgaaatcataatgcttcataatagggctcgtttagaaattgct
aaatattgcggcgagcccattattgacttaattgttgcagggtttgaaggatag

DBGET integrated database retrieval system