KEGG   Thermotoga maritima MSB8: THEMA_08355Help
Entry
THEMA_08355       CDS       T02976                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tmi  Thermotoga maritima MSB8
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THEMA_08355
Enzymes [BR:tmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     THEMA_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1598265..1600214
Genome map
AA seq 649 aa AA seqDB search
MLGVCYYPEHWGTEKVEEDFRRMKELGIEYVRIGEFAWSRIESERGKFNWDWLDKTLELA
EKMGLKIVLGTPTATPPKWLIDEHPEILPVDKDGRVKNFGSRRHYCFSSPVYREEVKRIV
TIIVKRYGKHPAVAGWQTDNEYGCHDTVRCYCPRCKKAFQKWLERKYEGDIKKLNEAWGT
VFWSQEYRSFDEIELPNLTPADPNPSHLLDYYRLASDQVVEFNKLQVEIIREYSPGRFIT
HNFMSGFTDFDHYKLSKDLDFATWDNYPLGHTLVFLRMKGETKNPFDRVGHPDIISFSHD
LYRGVGRGRFWVMEQQAGPVNWAPYNLWPAKGAVRLWTWQAFAHGAEVVSYFRWRQAPFA
QEQMHSGLLAPDSAPYPGYHEVKQVFEELKNIDINEPVESEVALVFDYETAWVFSIQPHG
EGVNYIDLVFRFYSALRRLGLNVDIVPPGSSLDGYKMIVVPSLAIVKEEVLDTFKKYDGL
LVLGPRSGSKTETFQIPPEMPPGLLKEIIPVEVRQVESLGDNVETLVWNGKEYPVSIWRE
DVDPTITEVIARFKDGFGAIFRKENVFYLAFWPNGDFLVDFFEALSKESGIETKRMPEGV
RIQRRGEYVFSFNFTSEEVDLEIPTKVQIVLGDQKIPPYGLLIWKENER
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgtctgttactatccagaacactggggaacagagaaagttgaagaagacttc
agaaggatgaaagaactcgggatagagtacgtgaggattggagagttcgcctggagcagg
atagagtcggagcgtggaaagttcaactgggactggctcgacaaaacacttgagctggca
gagaagatggggctcaagatcgtactgggaactcccacagccacacctccgaagtggctc
atcgatgaacacccggagatccttcccgttgataaagatggcagggtgaaaaattttggt
tccagaagacattattgcttctccagccctgtttatagagaggaagtgaaaagaatcgtc
accataatagtgaaaagatacggaaaacacccggcagtcgcaggctggcagacggacaac
gagtacggctgtcacgatacggtgaggtgctactgtccgaggtgcaaaaaagccttccaa
aaatggctggaaagaaagtacgagggagacataaagaaattgaatgaagcgtggggaaca
gtgttctggagccaggagtatcgatccttcgacgaaatagagcttccgaatctcacccct
gccgacccgaacccgtcgcatcttctcgactactacaggttagcctccgaccaagtggtg
gaattcaacaagctccaggtggagataataagggagtattcgccgggaagattcatcaca
cacaatttcatgtccggtttcacagattttgatcattacaaactctcgaaagacctggat
ttcgcaacctgggacaattacccgctcggacacaccctcgtttttctgagaatgaagggt
gagacaaaaaatccgttcgacagagtgggacacccggacatcatctcattctcgcacgat
ctgtaccggggagtgggcagaggaagattctgggtgatggaacagcaagcaggacctgtg
aactgggctccttacaatctctggcccgccaagggagcggtgagactctggacgtggcag
gcgttcgcacacggtgcggaggtggtctcctacttcagatggagacaggcaccttttgcg
caggagcagatgcactctggacttctggcaccggattcagcaccttaccctggataccac
gaggtaaagcaggttttcgaggagctcaaaaacatcgatatcaatgagcccgtggaaagc
gaagtggcacttgtcttcgattatgaaacggcgtgggtcttctccatacaaccgcacggc
gagggggtgaactacatcgatcttgtcttcagattctacagtgccctcagaagactcggt
ctgaacgtggatatagtaccccctggatcttcactggacggatacaaaatgatcgttgtt
ccaagccttgccatcgtgaaggaggaggttctggacacgttcaaaaaatacgacggtctt
ctcgtacttggcccaagaagcggaagcaaaacagagacattccagataccaccagaaatg
cccccaggtcttctcaaggagatcatacccgttgaagtgagacaggttgaaagccttgga
gataatgttgagacacttgtttggaacggtaaggaataccctgtctcgatatggagagag
gatgtggaccccaccatcacggaagtgatcgcaagattcaaagatggttttggagccatc
tttcgaaaggaaaacgtcttctaccttgctttctggccgaatggagactttctcgtagat
ttctttgaagcactttcaaaagaatcaggaattgaaacgaaaaggatgccagaaggagta
cgcattcaaaggagaggtgaatatgttttttctttcaatttcacctctgaggaggtagat
ttagaaataccaacgaaagttcagatagttctaggagatcaaaagattcctccctatgga
ctgctgatatggaaggaaaacgaacgctga

DBGET integrated database retrieval system