KEGG   Tuber melanosporum: GSTUM_00006856001Help
Entry
GSTUM_00006856001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tml  Tuber melanosporum
Pathway
tml00010  Glycolysis / Gluconeogenesis
tml00051  Fructose and mannose metabolism
tml00052  Galactose metabolism
tml00500  Starch and sucrose metabolism
tml00520  Amino sugar and nucleotide sugar metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
Module
tml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00006856001
   00051 Fructose and mannose metabolism
    GSTUM_00006856001
   00052 Galactose metabolism
    GSTUM_00006856001
   00500 Starch and sucrose metabolism
    GSTUM_00006856001
   00520 Amino sugar and nucleotide sugar metabolism
    GSTUM_00006856001
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GSTUM_00006856001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GSTUM_00006856001
Membrane trafficking [BR:tml04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GSTUM_00006856001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 9188186
NCBI-ProteinID: XP_002839047
INRA: GSTUM_00006856001
UniProt: D5GFE5
LinkDB All DBs
AA seq 497 aa AA seqDB search
MYLSASRKPPSRKGSMHDVPNDLMKHIHELEKMFTIDTPKLHEIVSVFQEELIKGLSVAG
GTIPMNPTWVIGYPTGDETGTYLALDMGGTNLRVCEVELPEEKGQYEICQSKYRLPEEIK
SGTGEQLFDYIAECVKQFLVANHDGQDVKDLKELHLGFTFSYPCEQNAIDHGILQRWTKG
FDIEGVEGHDVVPMFEAALERKGVPIKITALVNDTTGTLIASAYTDNTTRIGCIFGTGCN
AAYMETVGSIPKLAHMNLDPKLDIAINCEWGAFDNEHRVLPRTVYDKHIDEHSPRPGQQT
FEKMVAGLYLGEIFRLVLVDLHSNPDVKIFEKQDISALQTEYSLDSSFLAEIESDPWENL
METHALFEKKLKIETTEPERKLIRRLSELIGTRAARLSACGVAAICKMKNIESCHVGADG
SVFNKYPNFQERGAKALREIFGWGRAVRKDPIQIVPSEDGSGVGAALIAALTMKRIRGGI
HAGVNVKRKNSLIPPVP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcagtgcatctcgcaagccgcctagccgcaaaggctccatgcacgatgtgccg
aacgatctcatgaagcacatccatgaactcgagaagatgttcaccattgatacgccaaag
ctccatgagattgtatccgtattccaagaggaactgatcaaggggttatctgtggcaggc
ggcacaattcccatgaacccaacctgggtgattggatatcccactggcgatgagacgggc
acctacctcgctcttgatatgggcggaacaaatcttcgtgtttgcgaggttgagcttcct
gaagagaagggccagtatgaaatctgtcagtccaagtaccgccttccagaagagatcaaa
tctggcactggggaacagctttttgattacattgccgagtgtgtcaagcaattcttggtc
gcaaatcatgacggccaagatgtcaaggatctgaaggagctacatcttggttttaccttc
tcatatccgtgcgagcagaatgctattgatcatggtatcttgcaacgttggaccaaaggt
ttcgatattgaaggtgttgaaggccatgacgttgttcccatgttcgaagctgctctcgag
agaaagggggtcccaatcaaaattactgctttggtcaatgacaccactggaactctgatc
gcttctgcgtataccgacaatactaccagaatcggttgcatcttcggtactggttgtaat
gctgcctacatggagaccgttggctctattcctaagcttgctcatatgaatcttgatcct
aaactcgatattgctattaattgtgaatggggggcgttcgacaatgaacatcgtgtcctt
cctcgcactgtatatgacaagcatatcgatgagcactctccccgcccaggacagcaaaca
ttcgagaagatggttgcaggtctttacttgggagaaattttccgtttggttcttgttgat
ctccattccaaccctgacgttaagatctttgaaaagcaggacattagtgctcttcagact
gagtattccttagattcttccttcctagccgagattgagagtgatccatgggagaattta
atggaaactcatgccctctttgagaagaagttgaagattgagactaccgagcctgagcgc
aagctcatccgtcgcctttcggagctcataggaactcgtgccgcccgcctttctgcctgt
ggcgttgcagccatttgcaagatgaagaacattgaatcttgccatgttggcgctgacggc
tctgtattcaacaagtatcccaactttcaggaacgtggtgcaaaagctcttcgcgaaatc
ttcggctgggggagggcggttaggaaggatcctatccagattgttccctctgaggacgga
agcggtgtcggtgctgctttgattgccgcactcaccatgaagcgtatcagggggggtatt
catgccggtgttaacgtcaagcgcaagaactcgttgattcctccagtcccgtaa

DBGET integrated database retrieval system