KEGG   Tuber melanosporum: GSTUM_00009671001Help
Entry
GSTUM_00009671001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
tml  Tuber melanosporum
Pathway
tml00250  Alanine, aspartate and glutamate metabolism
tml00280  Valine, leucine and isoleucine degradation
tml00410  beta-Alanine metabolism
tml00640  Propanoate metabolism
tml00650  Butanoate metabolism
tml01100  Metabolic pathways
Module
tml_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GSTUM_00009671001
   00650 Butanoate metabolism
    GSTUM_00009671001
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSTUM_00009671001
   00280 Valine, leucine and isoleucine degradation
    GSTUM_00009671001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSTUM_00009671001
Enzymes [BR:tml01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GSTUM_00009671001
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     GSTUM_00009671001
Amino acid related enzymes [BR:tml01007]
 Aminotransferase (transaminase)
  Class III
   GSTUM_00009671001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9184741
NCBI-ProteinID: XP_002840888
INRA: GSTUM_00009671001
UniProt: D5GKN6
LinkDB All DBs
AA seq 479 aa AA seqDB search
MASTLRHSSRLGIRTARFVLPRGRNAYATVAPFFSNEPIQPSVMTPIPGPVSRKAIEELD
SVFDTRSLNMICDYKKSVGNYLVDMDGNVSLPIPGNTIASIPVGYNNPRLIAAMSSKEAV
DALVNRPALGGFPPAYWASLLKTGILAVAPKGLDQVFTAMAGSDAIETSYKAAFIYRRRI
ERGEGVDFTPQEIESVMKNQAPGSPELTIMSFKKAFHGRLFGSLSTTRSKPVHKLDIPSF
DWPQASFPRLEYPLEDNIEANKKEEERCLAEVEDRICSWPIAAVVVEPIQSEGGDNHASP
AFFQGLRDLTKKKGVLLIVDEVQTGVGATGKFWAHEHWNLESPPDMVTFSKKAQTAGYYF
GNPLLRPNLPYRQFNTWMGDPVRAILFRAIIQEIAKHDLIKNTAETGDYLYRELEKLASS
FPERVQNLRGKDRGTFIAFDTPERDALLKKMKTFGVNIGGSGETAVRLRPMLVFQKHHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaactcttcgtcattcctcccgtctcgggatccgtactgctcgcttcgttctt
ccaaggggtcgaaatgcatacgcaacggttgccccctttttcagcaatgaaccaattcag
ccttcagtgatgacaccaatccctggacctgtttccaggaaagcgatcgaagaattggat
tctgtgttcgacaccaggagcttgaacatgatatgtgattataagaagagtgttgggaat
tatcttgttgacatggatggcaacgtgagcttgccgatccctgggaacactattgcttca
atcccagttggctacaataaccctcgtctcattgcagctatgtcttccaaagaggctgtc
gatgctctcgtaaataggcctgctcttggtggctttcctcccgcatattgggcttctctc
ctgaagactggaatacttgcggttgcaccgaagggtttggatcaggtattcactgccatg
gctggatctgatgcaattgaaacctcttacaaggctgcattcatttacagacgtcgtata
gaacgtggcgaaggtgtggattttactccccaagagattgagagtgtcatgaaaaatcaa
gctcccgggtctcccgagttgacaatcatgagcttcaagaaggctttccatggtcggttg
tttggaagtttaagcactaccaggagcaagccagttcataagctcgacatcccttctttc
gattggcctcaagcttcgttccctcggttggaataccccttggaggataatatcgaagca
aacaaaaaggaggaagagagatgtctagcagaagtcgaagataggatttgttcttggcca
attgctgctgttgtcgttgagcccatccaatctgagggtggtgacaatcacgcatctccg
gcctttttccagggccttcgggacctgacgaagaaaaagggcgttttgcttattgtcgat
gaggttcagactggtgttggagcgaccggcaagttctgggctcatgagcactggaatctc
gagtctccgccagatatggtcactttttccaagaaggctcagaccgcgggttactacttt
ggcaatcctttgttgagaccgaatttgccatatcgccagttcaatacctggatgggagat
cctgttagagcgattctttttcgggccattattcaagaaattgcgaagcatgacttgatt
aaaaatacggccgaaaccggtgattacctctatagagagcttgagaagcttgcctccagt
ttcccagaaagggtccaaaatctccgtggaaaggatcgtggaaccttcattgcgttcgat
acgcctgagagggacgccctcctgaagaaaatgaagactttcggggttaatatcggtggt
tccggagagaccgctgtgagacttcgacctatgctcgtctttcaaaagcaccatggttag

DBGET integrated database retrieval system