KEGG   Phaeoacremonium minimum: UCRPA7_3097Help
Entry
UCRPA7_3097       CDS       T03102                                 

Definition
(RefSeq) putative elongation factor tu protein
  KO
K02358  elongation factor Tu
Organism
tmn  Phaeoacremonium minimum
Brite
Translation factors [BR:tmn03012]
 Eukaryotic Type
  Elongation factors
   UCRPA7_3097
 Prokaryotic Type
   UCRPA7_3097
Mitochondrial biogenesis [BR:tmn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    UCRPA7_3097
Exosome [BR:tmn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UCRPA7_3097
  Exosomal proteins of breast cancer cells
   UCRPA7_3097
  Exosomal proteins of colorectal cancer cells
   UCRPA7_3097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 19323413
NCBI-ProteinID: XP_007913849
UniProt: R8BQ77
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MSASLRTIAPFLRTARSSFRKPAHPLIALQRQSATPVLNLYRGYAVYERTKPHVNIGTIG
HVDHGKTTLSAAITKRQADKGMANFLDYGSIDKAPEERKRGITISTAHIEYSTEARHYSH
VDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKVD
ALEDPEMLELVEMEMRELLNTYGFEGDETPVILGSALCALDGRRPEIGEQKIDELLKAVD
EWIPTPERDLDKPFLMSVEDVFSIAGRGTVASGRVERGVLKKDSEVELVGKGGEVIKTKV
TDIETFKKSCDESRAGDNSGLLLRGVRREDVRRGMVITKPGSVSAHTEFLISMYVLSKEE
GGRHTGFHENYRPQMYIRTADESCALYFPEGTEDASSKMVMPGDNVEMVAKLHAPCAVEA
GQRVNIREGGRTVATGLITRIIK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatctctcagaacaattgccccgttcttacggacggcgcgctcctccttcagg
aaaccggcgcatcctttgatcgccctgcagagacagagcgcgaccccagtccttaacctt
tacagaggatatgctgtctacgagaggacgaagcctcacgtgaacatcggcaccattggt
cacgtcgatcatggaaagaccacactgtccgcagctatcacaaagagacaagccgacaag
ggaatggcaaacttcctcgactatggctccatcgataaggcgcccgaagagcgaaagcgt
ggtattaccatctcgacggcgcacatcgagtactccactgaggctcgtcactactcccac
gtcgactgtcccggtcacgccgattacatcaagaacatgattacgggtgccgccaacatg
gacggtgcaatcatcgtcgttgctgcgtccgatggtcagatgccccagacccgagagcat
cttctgctggcccgacaggtcggtgtccagaagattgttgtcttcgtcaacaaggttgat
gccctcgaggaccccgagatgttggagcttgtcgagatggagatgcgtgagctgctgaac
acatacggcttcgagggtgacgagacccccgtcatcctgggctctgccctgtgcgctctg
gacggccgccgaccagagattggcgagcagaagatcgacgagctgctaaaggccgtagac
gagtggatcccgacccctgagcgtgacctcgacaagcccttcctgatgtctgtcgaggat
gtcttctcgattgctggccgcggtaccgtcgcatctggccgtgtcgagcgtggtgtgctg
aagaaggattctgaggttgagctggtcggcaagggtggtgaggtcatcaagaccaaggtc
accgacatcgagaccttcaagaagtcctgcgacgagtcccgcgctggtgacaactctggt
ctgctgctccgtggtgtccgcagagaggacgtcagacgtggaatggtcatcaccaagcct
ggcagtgtttccgcccacactgagttcctgatctccatgtacgttctgtccaaggaggaa
ggtggtcgtcacaccggtttccacgagaactaccgccctcagatgtacatccgtaccgct
gatgagtcttgcgctctttacttccccgagggcaccgaggacgccagctccaagatggtc
atgcccggagacaacgttgagatggttgccaagctccacgcaccctgtgctgtcgaggct
ggccagcgcgtgaacatccgtgagggaggcaggaccgtcgccactggtctgatcactaga
attatcaaataa

DBGET integrated database retrieval system