KEGG   Phaeoacremonium minimum: UCRPA7_3778Help
Entry
UCRPA7_3778       CDS       T03102                                 

Definition
(RefSeq) putative glycoside hydrolase family 2 protein
Organism
tmn  Phaeoacremonium minimum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1260 aa AA seqDB search
MRATKEDRGPQFIVSTMDSVSPTCHTLRVPILDYEIFVTRDPENVRVLFSSPDFDISNTR
QASWMPLLGKGIFTSRGETWKHSRALLRPQFAREMISDLELEEKHLQVLMGQLPTDDSNG
WTSKIDLQPLLFRYTLDTVTEFLYGKSVNSLITAQNGGAGANSDIAKHFDQAKVWIDKRG
ALAKFYWLLTSKEFDENCKTIHSYADAIVADRLAHPPPEKVSSDPEKGKAFNLLDELAKV
TQDPKQLRNETLHVLIAGRDTMGSLLGWVFYFLARHPDVFERLRQTLLNSFGDTPPDFRA
VRDCKYLQWVINETLRVATVIPMNERRALRDTVLPTGGGPDGTSRVFIPEGTQVLIPFYA
LQHRADLWGADVEEFKPERWEVKRPGWEFIPFGGGARKCLGQQFALTQVGYVVARFCQQY
DRIENMEQGDGKIRLHHAIENRSGTGVQCNCTLKQWVLPSANDFVKGAKIQSPSGTPPGS
SIQYTQSSFDDRQWETVNLPHDWAIKGPFNAPGVSGGMGRLPSNGVGWYRRNITVTSDDV
GKTIFLDVDGAMSYATVWLNGNLVGGWPYGYASFRLDLTPYLKVGDDNILAIRVDNALNN
SRWYPGAGIYRNVWLVKVNSVHVGQYGTYITTPTVSKDSATVNLVVDVENKGNTSQQVDV
STEVHLLDPSTGRAGGDVMASFKPVTATVAMGKKQSVNGSVSIAKPLLWGPKPIQSPNLY
VAITTLSIGGSVVDTYETQFGIRAIKYDADKGILINDQAVPIQGTCNHHDLGSLGSAFNI
RAAERQLQMLQEMGSNALRTSHNPPAPEILDLADRMGILVLDEIFDCWNNQKTTNDFHLI
FADWHEPDLRSFIRRDRNHPSIMAWSVGNEVGEQSSAAGGTTAQGLRDIARDEDPTRPVT
VAMNAASAGSSLANVLDIEGLNYQGEGLGTSTSGSFSSFHQKYPGKVIWASESSSAVSTR
GTYFFPVTSGKSATVGNGSGGNSSALQVSAYELYATSWGSSPDKVFEAHERNPYVAGEFV
WTGWDYLGEPTPYDSARSSYFGIIDMAGFEKDRFYLYQSHWRPDFPMAHILPHWTWPERA
GQVTPVHVFSSGDEAELFVNGKSAGRVKKAQNTYRFRWDNVVYQPGNISVVAYKNGTQWA
TDSKRTVDIAAKLNITADRTAIKGDGDDLSFIRVAVVDSNGDVVPRANHAVTFSISGPGQ
IVSTDNGDPADMTAFPSLTRKAYSGMVLAIVRADAGAAGKITVSASATGLTTATLGLQVQ
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaccaaggaagatagaggaccgcagttcatcgtgtctaccatggacagcgtg
tctcctacttgccatacccttcgagtacccatccttgactacgagatctttgtcacgcgc
gacccggagaacgtgagagtcttgttctcaagccccgactttgacatcagcaacacaaga
caagcatcgtggatgcccctcctcggcaagggcatctttactagccgcggcgagacttgg
aagcacagtcgcgcgctattgcgcccacagtttgccagagagatgattagtgatttagag
ctggaggagaagcatctccaagtcttgatgggccaactaccaacggatgattctaatggc
tggacatcaaagattgatctacagccactgctattccgatacacactagacactgtaacc
gagtttctgtatggaaagtctgtcaactcgttgatcacggcgcagaacggcggagcaggc
gcaaacagtgacatcgccaaacactttgaccaagccaaagtctggattgacaagcgcggt
gcactggctaaattttactggctgctgacaagcaaggagtttgatgagaactgcaagacc
atccatagttatgccgatgcaattgtcgctgaccgcctggctcatccgcctccggaaaaa
gtgtcgtctgaccctgaaaaaggcaaggcattcaacctcttggacgagcttgccaaagtc
acgcaagacccgaagcaactccgaaatgagacacttcacgtgctcattgctggaagagac
acaatggggtctctcctcggctgggtcttttacttcctcgcccgtcacccggacgtcttt
gagaggctacggcagacactgctgaacagcttcggtgacacgccgccagactttagagcc
gtgcgagactgcaagtatctgcaatgggtcatcaatgagactctacgagtcgcgactgtc
attccaatgaatgagcgcagagccttgagggacaccgtcttgccaacaggtggagggcca
gacggcaccagtagggtattcattcccgaaggcacacaggttctcatcccgttctacgcg
ctgcaacaccgcgcagacctgtggggtgcggatgtggaagagttcaagcccgaacgatgg
gaggttaagagacctggttgggagttcatcccctttggaggtggtgcgcgcaagtgcctt
ggtcaacaattcgccctcacacaagttggatacgttgtagcccgcttctgccagcagtat
gacagaattgagaacatggagcaaggtgatggcaaaatcagactgcaccacgcaatcgaa
aaccgaagtgggactggcgtccagtgcaattgcacgctgaaacaatgggttctcccctca
gccaacgacttcgtcaaaggcgcgaagatccaatcaccctctggaactcctcccggcagc
agcattcagtatacacagtcatcatttgacgataggcaatgggagactgttaatctaccc
catgactgggccatcaaggggcccttcaatgctcctggcgtatcgggtggcatgggtcgc
ctaccttcaaatggagtcggctggtaccgccgtaatattacagtgacatcagatgatgtg
ggcaagactatattcttggacgtggacggtgctatgtcttatgcgactgtctggctgaac
ggaaacttagttggtggatggccgtatggctatgcctcgttccgactggatcttactcca
tacctgaaagttggcgacgacaacattttggctattcgagtggacaatgcgctaaataac
tcacggtggtaccccggtgctggcatatatagaaatgtctggctagtaaaagttaattcg
gtgcatgttggacagtacgggacatatatcacaacgccaactgtctctaaagactctgcc
acagtcaacctagtggtcgatgttgagaacaaaggaaacactagccagcaggttgatgta
tcaacagaagtccacttactcgacccgtcaactggccgagcgggcggcgatgtaatggct
agcttcaaaccagtaacagcaacggtggcaatgggaaagaagcagtctgtcaacgggtcg
gtgtcaatagcaaagccattgctatggggtccgaagccaatacaatcgccaaatctatat
gttgccataacgactctatcaatcggtggaagtgtggttgacacatatgagacgcaattc
ggcattcgcgcgattaaatatgacgcggacaaaggcattttaatcaatgaccaggcggtg
cccatacagggcacttgcaaccatcacgatctcggctcccttggatccgcgttcaacatc
cgagcggcagagaggcagctgcagatgttgcaagaaatgggtagtaatgcgttgaggaca
tcacacaacccacctgctcctgagattctggatcttgcagatcgaatgggtatcttggtc
ctggatgagattttcgattgttggaataaccaaaagacgacgaatgatttccatttgatc
ttcgcggattggcatgagcctgatctccgctctttcattcggcgggatcgtaaccaccct
tcgattatggcatggagtgtcggcaacgaggtcggagaacagtcgagcgcagctggtggc
acgactgctcagggcctacgcgatatagcccgcgatgaggatccgacgcgcccggtcacc
gtggcgatgaatgcggcttcggctggtagctccttagccaatgtcctggatattgaaggc
ttgaattatcagggtgaaggtcttggcacatcgacatccggatccttctcgagcttccat
cagaagtacccgggcaaagtcatatgggccagcgagagctcctccgctgtcagtacccgt
ggcacgtacttcttcccagtgaccagtggcaagagcgcaacggttggtaacgggtcgggt
ggaaactcctcggccttgcaagtcagcgcttatgagctgtacgcaacttcatggggatca
tcgcctgataaggtctttgaggcgcatgagagaaacccctatgtggctggtgaatttgtg
tggacgggctgggactacctcggtgagcccacgccgtacgattcagcccgcagctcctac
tttgggatcattgatatggccggtttcgagaaggaccgtttctacttgtatcaatctcat
tggcgtcctgacttccccatggctcatattctaccccactggacctggccggagagagct
ggacaggtcactccggttcacgtgttctcatcgggggacgaggcggaactttttgtgaat
ggaaagtctgcagggcgagtgaagaaggcacagaacacataccgcttccggtgggataac
gtggtctaccagccaggcaacatcagtgtggttgcttacaagaacggaacacaatgggcc
acggactctaaaagaaccgttgatatcgctgctaagctgaacatcacggctgaccgaact
gccatcaagggagatggggatgatttgtccttcatcagggttgcggttgtggatagcaac
ggcgatgtagtcccgcgcgcgaaccatgcagtcacattctcgatctctgggcccggtcag
attgtgtctacagacaatggcgacccggcggacatgactgctttcccatcattgacacga
aaggcttatagtgggatggtattagcaattgtccgggctgatgccggcgccgcaggaaag
atcactgtgtcggcttcagcaaccggtcttactacagctaccttaggccttcaagttcaa
tga

DBGET integrated database retrieval system