KEGG   Phaeoacremonium minimum: UCRPA7_5828Help
Entry
UCRPA7_5828       CDS       T03102                                 

Definition
(RefSeq) putative glycogen synthase protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
tmn  Phaeoacremonium minimum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRPA7_5828
Enzymes [BR:tmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     UCRPA7_5828
Glycosyltransferases [BR:tmn01003]
 Polysaccharide
  Storage polysaccharide
   UCRPA7_5828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 705 aa AA seqDB search
MSTDDGDRAPREVKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQ
SAAVEVEELEPTNPELAATIQSMRDRGIGMLYGRWLIEGAPRVLLMDTKTAYQYLNEWKT
DLWNVASIPSPPGDDETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLTK
KRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDSEAGKRGIYHRYCIERAAAHSC
DVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQSKEKIHDFVRGHF
YGHYDFDPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKAVGSKTTVVAFIIMPAQT
TSLTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSLKWHDGDPLPDEKELITTQDRVLL
RRRLFAMKRHGLPPIVTHNMLNDHEDPILNQIRRVQLFNHPSDRVKIVFHPEFLNSANPV
LPMDYDDFVRGTHLGIFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDY
GIYIVDRRTKGVDDSVNQLTSCMFDFAQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKA
RQLALRRAYPESFDGDEDEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREG
LGTEDYVAWKLPEEEDPDEYPFPLTLRTKRSGPASPLDGVQLNGN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacgacggagatcgcgcacctcgagaggtgaagaaccaccttctcttcgag
atcgccactgaggttgcccatcgagtcggcggtatttactccgtcatcaagtccaaggcc
ccagtgacgactgccgaatatggcgaccgctatacgctgatcggtcctctcaaccaccaa
tctgctgccgtggaagtcgaggagctagaacctaccaaccccgagctggctgcgaccatt
cagtccatgagggatcgtggcatcggtatgctctatggtcggtggttgattgaaggagcc
ccaagggttctcctcatggacacaaagactgcctaccaatatttgaatgagtggaagacg
gacttgtggaacgttgcctctattccctcgccaccgggcgatgacgaaaccaacgaggcc
attgtatttggatatcttgtcgcttggttccttggtgagtttgtctgtcatgagaagaag
aaggccgtaatagcccacttccatgaatggctagcaggcgttgcactacctcttaccaag
aaacggcgcattgatgtgacaactatctttacaacccacgcaacgctccttggtagatat
ttgtgcgctggttctgttgacttttacaacaacctccaatatttcgatgtcgactctgaa
gccggaaagcgtggcatataccacagatactgcatcgagcgagccgccgcccactcgtgc
gacgtcttcacaactgtctcccacattacggcttatgagagcgagcacttgctgaagcgt
aaacctgatggagtcttgcctaacgggcttaacgttaccaagttctcggctatgcacgag
ttccagaatctccaccagcagtccaaggagaagatccatgacttcgtccgaggacacttc
tacggtcattatgattttgatccggagaacaccttatacttcttcacggcgggtcggtac
gagttcaggaataagggtgtcgatatgtttattgaatcactcgcccgtctcaaccaccgc
cttaaggctgtcgggagcaagacaactgttgtcgctttcatcatcatgccggcgcagaca
acttccctgaccgtggaggcgctgaagggccaggcagtgataaaatcgctgagagatacg
gtcgatgtgattgagcgaggcattggcaggcgcattttcgagcgctccctgaagtggcac
gacggagatccgctgccggatgagaaggagctaatcactactcaggatcgggtcctcctt
cgtcggcgactctttgccatgaagcgtcacggcctccccccaatcgtgacacataacatg
ctgaacgaccatgaggatccaatcttgaaccaaatccgtcgcgtacagctctttaaccac
ccctcggaccgtgtcaagattgtgtttcaccccgagttcttgaactctgccaatccagtg
ctcccaatggactacgacgacttcgtgcgaggaacgcatttgggcatcttctcctcttac
tacgagccgtggggctacacgccagctgaatgcacggtcatgggcgtgcctagcatcacc
accaacctgtcgggctttggctgctacatggaggagctcattgagaactctagtgattac
ggtatctacattgtagatcgtcgtactaagggcgtggatgattcggtgaaccaattgacg
tcgtgtatgtttgattttgcccagaagagccgccgtcagcgtatcaatcagcgaaaccga
acagagcgcctcagcgacctcttggactggaagcgaatgggtatggagtacgtcaaggct
cgccagctagctttgaggcgggcttaccccgagtcatttgacggcgacgaggatgaggac
ttcattcccggtgtcgagcagaagatctcgcggcccttctctgtcccaggatctcctcgt
gatcggactggaatgatgaccccgggagactttgcaagtttgcaggaaggccgagaagga
ctaggcacggaggattatgtcgcctggaagctcccagaggaagaggatcccgatgagtac
ccgttccctctcaccctgaggacgaagcgctcgggaccggctagtccgcttgacggtgtc
caactcaacggcaactag

DBGET integrated database retrieval system