KEGG   Phaeoacremonium minimum: UCRPA7_7381Help
Entry
UCRPA7_7381       CDS       T03102                                 

Definition
(RefSeq) putative dna ligase 4 protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    UCRPA7_7381
Enzymes [BR:tmn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UCRPA7_7381
DNA repair and recombination proteins [BR:tmn03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     UCRPA7_7381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 995 aa AA seqDB search
MSQNKRPASPTDSAKDEDERQYGAGPLTLEELEEKYPNRPRNHSKTLLFSELYRSLFNPL
NENKAQPSGPRVARKKVGPHGPSKLSPHEQRRAIIQRFISRWRAEVGSDFYPALRLILPD
KDRDRGVYGLKENTIGKLLVKLMKIDKNSEDGYNLLHWKLPGQTTASRMAGDFAGRCFEV
LSKRQMRTEPGNMRIAEVNELLDKLAGASGEAEQLPIFDIFYKRMNAEELMWLIRIVLKQ
MKVGATERTFLDLWHHDGEALFSVSSSLRRVCWELHDPEFRLEEDESGINLMQCFQPQLA
QFQMPESFQKMVTHLGATEENPEFWIEEKLDGERMQMHMMEDEETPGGVKFCFWSRKAKD
YTYLYGNGFEDDNSALTRHLKEAFSDRTKNCILDGEMITWDPKTDKIVPFGTLKTAALSG
QKNPFDDSSERPVYRVFDILYLNDKPLTKYTLRDRHRALETAVPGVPGRLEIHPHIAATS
PDAIEPQLRKIVAEASEGLVLKNPKSMYRLNSRNNDWIKVKPEYMSEFGESLDCVVIGGY
FGSGRRGGNLSSFLCGLRASENYIKAGVNPEKCWSFFKVGGGFKAEDYAEIRHRTEGKWI
DWDANNPPSEYVELGGGEKLQYERPDVWIRPKDSIVISVKAASIGQSDSFAIGETLRFPR
FRRLRLDRSWDSALDIDQLHALKSRVDQEAQEKKNMEIEDRRSRRSTKRVKRETVIAGQT
RSGGADGNGQPRTQVFEGMTFLVLSEALKPIRKTRDELVALVKENGGQAVLEEKQNVDSL
IVVADKKVVKAAAIIKRGERDVIKPKWIIDSINQGYPLPFEKGHLFWATDAMAKIAENNT
DQYGDSYARDAEVEELREILANMPKLDLGEGNFDKETFLTELEEHGHELPNLKGWTFRRC
RIFFAVSEDVWDVTVMMLRNYVQFGSATVAETLDDESITHVVVVARDETAKRELAADVRY
QISSRKSVPRVVTDKWVMDCWEASTLVDEEQYAPL
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaacaagcgaccagcatcgcctaccgattccgcgaaggatgaggatgagcga
caatatggcgcaggacccttgacactggaggagctggaggaaaaatacccgaaccgtccc
cgcaaccactctaagacactactcttctccgagctctatcgctcgctcttcaaccccctc
aacgagaataaggcacagccctctggcccgcgggtcgcacgcaagaaagtcggccctcat
ggaccatccaagctcagcccacacgagcaacgccgcgccatcatccagcgcttcatctca
cgatggcgtgccgaggttggcagcgacttctacccagccctacgactaatcttgcctgac
aaggaccgcgaccgtggcgtctatggcctgaaggagaatactattggtaagcttctcgtc
aagctcatgaagatcgacaagaactccgaggacggctacaatctcctccactggaagctg
ccgggacagaccacagcgagccgcatggcgggcgactttgccggccgctgcttcgaggtg
ctgagcaagcgtcagatgcgtacggagcccggtaacatgcgcatcgccgaggtcaacgag
ctgctggacaagcttgcgggcgcgagtggcgaggccgagcaactgcccatcttcgatatc
ttctacaagcgcatgaatgccgaggagcttatgtggctcatccgcattgtgctcaagcag
atgaaggtcggtgccactgagcgtaccttccttgacctttggcatcatgatggtgaggcg
ctgttcagcgtcagcagcagcttgcgccgtgtttgctgggaactgcacgacccggaattt
cgtctggaggaagacgagtctgggatcaaccttatgcagtgctttcagccacagctggcg
cagttccagatgcccgagagcttccagaagatggtcactcacctgggtgcgacggaggag
aaccccgaattctggatcgaggagaagcttgacggcgagcgaatgcagatgcacatgatg
gaggatgaggagacgcctggaggcgtcaaattctgcttctggtcacgaaaggcgaaggat
tacacatatctctacggcaatggctttgaggatgacaactcggcgctcacacgacacctt
aaggaggcgttttctgaccggactaagaactgtattctcgacggagagatgatcacctgg
gacccgaagaccgacaaaatcgtcccgtttggtacactcaagactgcggccctgtcaggg
cagaagaaccccttcgatgactcaagcgaacgtcctgtgtaccgcgtcttcgacatcctg
tacctcaacgacaagcccctcaccaaatacacactgcgagatcgacatcgtgctcttgag
acggccgtcccaggtgttcctggtcggctagagatccaccctcatatcgcggcaacttcc
ccggacgcgatcgaaccccagcttcgcaagattgtcgcggaagcgtcagagggcctcgta
ttgaagaaccccaagtccatgtaccggctcaacagtcgcaacaatgactggatcaaggtc
aagccagagtacatgtccgagtttggcgaatcgcttgactgtgttgttatcggcggttat
ttcggctctggccgtcgtggtggcaatctgtctagttttctttgtgggctgagagctagt
gagaactacatcaaagctggcgtgaaccctgagaagtgctggagcttctttaaggtcggc
ggtgggttcaaggcggaggactatgctgagattcggcaccgcaccgaaggaaagtggatc
gactgggatgcgaacaatcctccctccgagtacgtcgagcttggcggcggcgagaagctg
cagtatgagcggccagacgtctggatcaggccgaaggacagcatcgtcatctccgtgaaa
gccgccagcattggacagtctgattcgttcgctattggcgagacgctgcgctttcctcgc
ttccgacgactgcgactcgatcgctcctgggactcggccttggatattgatcagctgcac
gcgcttaaaagccgcgtggatcaagaggcgcaggagaagaagaacatggagattgaagat
aggcgcagtcggcgttcgaccaagagagtcaagcgggagactgtcatcgctgggcagacc
cgctctggaggtgctgatggcaacggccagcccaggacacaggtgtttgagggcatgacg
ttcttggtgctgagtgaggctctcaagcccatccgcaagacgagagatgagcttgtggct
ctggtcaaggaaaatggcggacaggctgtcctggaagagaagcagaacgtggactcactg
atcgtcgttgccgataagaaggtcgtcaaggcggccgctatcatcaagagaggggagaga
gacgtcatcaagcctaaatggatcatcgacagcatcaaccaaggctacccgttgcctttc
gagaaaggtcatctattctgggccacagatgcgatggcaaagattgcggagaacaacacc
gaccagtatggcgacagttatgcacgagatgctgaagtagaggagctccgagagattctc
gcgaacatgccaaagctggatttgggcgaaggcaatttcgacaaggagactttcctcacg
gagcttgaggaacacggccacgagttgccgaacttgaaaggctggaccttccgcagatgc
cggatcttcttcgccgtcagcgaggacgtctgggacgtcacggtgatgatgctccggaat
tatgtccagttcggcagtgccactgtcgcggagacgctggacgacgagtccatcacgcat
gttgtcgttgttgctcgtgacgagactgccaagcgggaacttgctgctgacgtgcggtat
cagatcagctcgaggaagtcggtgcctcgcgtcgtcacggacaagtgggtgatggattgc
tgggaggcgagcacccttgtggatgaggagcagtatgctccgctgtag

DBGET integrated database retrieval system