KEGG   Phaeoacremonium minimum: UCRPA7_8694Help
Entry
UCRPA7_8694       CDS       T03102                                 

Definition
(RefSeq) putative histone deacetylase rpd3 protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tmn  Phaeoacremonium minimum
Brite
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UCRPA7_8694
Chromosome [BR:tmn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     UCRPA7_8694
   HDAC complexes
    Sin3A-HDAC complex
     UCRPA7_8694
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    UCRPA7_8694
  Chromatin remodeling factors
   NuRD complex
    UCRPA7_8694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MTDPAGVDRSHPLYSPVSVNKKRVAYFYDSDIGNYAYVTGHPMKPHRIRLAHSLVMNYNV
YKFLEVYRAKPAVFTEMTQFHTDEYIDFLQKVTPDNMDSYLKEQGKYNVGDDCPVFDGLF
EFCGISAGGSMEGAARLNRQKCDIAINWAGGLHHAKKSEASGFCYVNDIVLAIIELLRFK
KRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGIGTGKNYAVNFP
LRDGITDASYKTIFEPVISAVMEYYQPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNF
VRGFGLPTLVLGGGGYTMRNVARTWAYETGRLVGVEMDPVLPYNEYYDYYGPDYELNVRP
SNMENANSTDYLEKIKIAVIENLKKTAPVPSVQMQDTPRQGLGMTDEEEAELDDLDEDEH
KDERVTQRQWEKSITREDEFEESDDEDMATANGVHKTNGKRMGIMDYKNPHADTDMDSGA
ITPVNGQRDGSVAPAAEDEPEAENENHDGDETMEDVEAQPKDVAVDATNEDKPAEPAAKV
DNDGDVDMEAAAEPETTIKQEETEPAPASEDKVASPKATEEPKDKETGSPKASAEPEKAT
TPAQGSDKMEVEVKDDAPAASAEPDKEKES
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccgcgggagtcgaccgctcccatcctctctacagcccggtgagcgtgaac
aagaaacgagtcgcctacttctacgactctgatatcggcaattatgcctacgtcaccggc
catcctatgaagcctcatcgtatcaggctggcgcatagcttggtcatgaattacaatgtc
tacaagtttctggaggtctatcgcgcgaagcccgctgtctttactgagatgacccaattt
cataccgacgagtacatcgacttcctccagaaggtcacaccagacaacatggacagttac
ttaaaagagcagggcaaatacaatgtcggagatgattgtcccgtgttcgatggcctgttc
gagttctgcggtatcagcgctggtggtagcatggagggtgccgcccgtttgaaccgccaa
aagtgcgacattgcaatcaattgggctggtggtctacatcacgccaagaagagcgaagct
agcgggttctgctacgtgaatgatattgttcttgccatcattgagctcctccgattcaag
aagcgcgtcttgtacatcgacattgatgtccaccacggagatggcgttgaggaggccttc
tacacaaccgaccgtgtcatgaccgtctccttccacaaatacggcgagtacttcccaggt
actggtgagctgcgcgacattggtatcggcacaggcaagaactatgccgtcaactttcct
ctccgcgacggtatcaccgacgcctcttacaagaccatcttcgagcctgtcatctctgct
gtcatggagtactatcaaccggaggcagtcgtcctccagtgtggtggtgacagcttgtct
ggtgaccgacttggctgcttcaatctgagcatgcgaggacatgccaattgcgttaacttc
gtgcgtggttttggactcccgactcttgttctcggcggtggtggctacacaatgcgaaac
gttgcccgaacatgggcttacgagaccggtcgtcttgttggcgtcgagatggatcctgtc
ctgccgtacaatgagtactatgactattatggtcccgactatgagctcaacgtccgtccc
tccaacatggagaatgcgaatagcaccgattacctcgagaagatcaagattgcagtcatc
gagaacctgaagaagacagcccctgtgccgtccgtgcagatgcaggacaccccgcgtcag
ggactcggtatgaccgacgaggaggaggcagaacttgacgatcttgatgaagacgagcat
aaggacgaacgggtcacccagcgccagtgggagaagagcatcacccgcgaagacgagttc
gaagagagcgacgatgaggatatggctactgcgaatggcgttcacaagaccaacggcaaa
agaatgggcattatggactacaaaaacccgcatgctgatacggatatggacagtggcgct
attaccccagtaaacggacaacgggatggttcagtggctccagctgccgaggacgagccc
gaggcggagaatgagaatcacgatggtgatgagacaatggaggatgtcgaggctcagcca
aaggatgtggccgttgacgccacaaatgaggacaagcccgccgaaccagctgccaaggtc
gataacgatggcgatgttgacatggaagccgcagctgaacctgagacgaccatcaagcaa
gaggagacagagcccgccccagcctctgaggacaaggtggcaagccccaaggccactgaa
gagcccaaggacaaggagacaggctcaccaaaggcatctgccgagcctgagaaggctacc
actcccgcgcaaggcagcgacaagatggaagttgaggtgaaagatgacgcccccgctgct
tcagcagagcccgacaaggagaaggaatcctag

DBGET integrated database retrieval system