KEGG   Thermotoga maritima Tma100: THMB_1221Help
Entry
THMB_1221         CDS       T03900                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tmq  Thermotoga maritima Tma100
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tmq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THMB_1221
Enzymes [BR:tmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     THMB_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1215052..1217001)
Genome map
AA seq 649 aa AA seqDB search
MLGVCYYPEHWGTEKVEEDFRRMKELGIEYVRIGEFAWSRIESERGKFNWDWLDKTLELA
EKMGLKIVLGTPTATPPKWLIDEHPEILPVDKDGRVKNFGSRRHYCFSSPVYREEVKRIV
TIIVKRYGKHPAVAGWQTDNEYGCHDTVRCYCPRCKKAFQKWLERKYEGDIKKLNEAWGT
VFWSQEYRSFDEIELPNLTPADPNPSHLLDYYRLASDQVVEFNKLQVEIIREYSPGRFIT
HNFMSGFTDFDHYKLSKDLDFATWDNYPLGHTLVFLRMKGETKNPFDRVGHPDIISFSHD
LYRGVGRGRFWVMEQQAGPVNWAPYNLWPAKGAVRLWTWQAFAHGAEVVSYFRWRQAPFA
QEQMHSGLLAPDSAPYPGYHEVKQVFEELKNIDINEPVESEVALVFDYETAWVFSIQPHG
EGVNYIDLVFRFYSALRRLGLNVDIVPPGSSLDGYKMIVVPSLAIVKEEVLDTFKKYDGL
LVLGPRSGSKTETFQIPPEMPPGLLKEIIPVEVRQVESLGDNVETLVWNGKEYPVSIWRE
DVDPTITEVIARFKDGFGAIFRKENVFYLAFWPNGDFLVDFFEALSKESGIETKRMPEGV
RIQRRGEYVFSFNFTSEEVDLEIPTKVQIVLGDQKIPPYGLLIWKENER
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgtctgttactatccagaacactggggaacagagaaagttgaagaagacttc
agaaggatgaaagaactcgggatagagtacgtgaggattggagagttcgcctggagcagg
atagagtcggagcgtggaaagttcaactgggactggctcgacaaaacacttgagctggca
gagaagatggggctcaagatcgtactgggaactcccacagccacacctccgaagtggctc
atcgatgaacacccggagatccttcccgttgataaagatggcagggtgaaaaattttggt
tccagaagacattattgcttctccagccctgtttatagagaggaagtgaaaagaatcgtc
accataatagtgaaaagatacggaaaacacccggcagtcgcaggctggcagacggacaac
gagtacggctgtcacgatacggtgaggtgctactgtccgaggtgcaaaaaagccttccaa
aaatggctggaaagaaagtacgagggagacataaagaaattgaatgaagcgtggggaaca
gtgttctggagccaggagtatcgatccttcgacgaaatagagcttccgaatctcacccct
gccgacccgaacccgtcgcatcttctcgactactacaggttagcctccgaccaagtggtg
gaattcaacaagctccaggtggagataataagggagtattcgccgggaagattcatcaca
cacaatttcatgtccggtttcacagattttgatcattacaaactctcgaaagacctggat
ttcgcaacctgggacaattacccgctcggacacaccctcgtttttctgagaatgaagggt
gagacaaaaaatccgttcgacagagtgggacacccggacatcatctcattctcgcacgat
ctgtaccggggagtgggcagaggaagattctgggtgatggaacagcaagcaggacctgtg
aactgggctccttacaatctctggcccgccaagggagcggtgagactctggacgtggcag
gcgttcgcacacggtgcggaggtggtctcctacttcagatggagacaggcaccttttgcg
caggagcagatgcactctggacttctggcaccggattcagcaccttaccctggataccac
gaggtaaagcaggttttcgaggagctcaaaaacatcgatatcaatgagcccgtggaaagc
gaagtggcacttgtcttcgattatgaaacggcgtgggtcttctccatacaaccgcacggc
gagggggtgaactacatcgatcttgtcttcagattctacagtgccctcagaagactcggt
ctgaacgtggatatagtaccccctggatcttcactggacggatacaaaatgatcgttgtt
ccaagccttgccatcgtgaaggaggaggttctggacacgttcaaaaaatacgacggtctt
ctcgtacttggcccaagaagcggaagcaaaacagagacattccagataccaccagaaatg
cccccaggtcttctcaaggagatcatacccgttgaagtgagacaggttgaaagccttgga
gataatgttgagacacttgtttggaacggtaaggaataccctgtctcgatatggagagag
gatgtggaccccaccatcacggaagtgatcgcaagattcaaagatggttttggagccatc
tttcgaaaggaaaacgtcttctaccttgctttctggccgaatggagactttctcgtagat
ttctttgaagcactttcaaaagaatcaggaattgaaacgaaaaggatgccagaaggagta
cgcattcaaaggagaggtgaatatgttttttctttcaatttcacctctgaggaggtagat
ttagaaataccaacgaaagttcagatagttctaggagatcaaaagattcctccctatgga
ctgctgatatggaaggaaaacgaacgctga

DBGET integrated database retrieval system