KEGG   Tremella mesenterica: TREMEDRAFT_24902Help
Entry
TREMEDRAFT_24902  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tms  Tremella mesenterica
Brite
Enzymes [BR:tms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TREMEDRAFT_24902
Chromosome [BR:tms03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     TREMEDRAFT_24902
   HDAC complexes
    Sin3A-HDAC complex
     TREMEDRAFT_24902
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    TREMEDRAFT_24902
  Chromatin remodeling factors
   NuRD complex
    TREMEDRAFT_24902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MTRFHTDEYIELLEMVNPDNAEILTGGGTRCLIGEDCPPFEGVFEFCTISAGGSISAAER
INSGHADIAINWAGGLHHAKKNEASGFCYVNDIVLAILELLRIHTRVLYIDVDVHHGDGV
EEAFYTTDRVMTASFHRFGEFFPGTGDVRDVGMGRGKGYAVNVPLRDGITNESFHYIFKP
VSSFIIQHIIDWFRPGAVVLQMGADSLSGDKLGGFNLTLDGHAECARFVKSFNIPTIMLG
GGGYTTKNVARAWTNETAVMCGRELPLDLPYNQYMEYYGPRYKLEVLPNNTDDHNPTTYL
DNIKKSVIEHLRSLPHAPAAQMKSRSSRGVGDVLGLKKDELSDPEDEIEATVKSAYLS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggtttcatacagacgagtacatcgagctgttggaaatggtcaatccggacaat
gccgagattttgactggcgggggtacaagatgcctaataggggaagattgtccacctttc
gaaggggttttcgaattttgcaccatctcggccggaggttctatcagtgctgctgaacga
atcaattctggccacgcagatattgccatcaattgggccggaggacttcatcacgccaag
aagaacgaagcaagtggattctgttatgtgaacgacattgtactcgccatcttggaactg
cttcgtatacacacgcgagtgctgtatatcgacgtagacgtacatcatggcgatggggtc
gaagaagcattctacaccaccgaccgtgtcatgaccgctagttttcatcgatttggagag
ttttttccaggaacgggagatgtcagagatgttggaatgggtcgcgggaaaggatatgca
gtcaatgtccctttgagagacggtatcacgaacgaatcattccattacatcttcaaaccg
gtcagctctttcatcatacagcacatcatcgattggttccgacccggtgcggtggttttg
cagatgggtgcggattccctgtctggtgacaagctcggtggattcaatctaacattggac
ggtcatgctgagtgcgcccgttttgtgaagagcttcaatatccccactatcatgcttggc
ggtggtgggtacacaacgaagaatgtcgcacgagcatggaccaacgaaacggccgtcatg
tgcggtcgtgagcttcctctagacttgccgtacaatcaatacatggagtattacggaccg
aggtacaaacttgaggttctgccgaataatacagacgatcacaatcctaccacctacctg
gacaatatcaagaaatctgtgattgagcatctgagatctctaccccacgctccggctgct
cagatgaaaagtcgatccagtcgtggtgtgggggatgtcctcggactgaagaaagacgag
ctttcagatccggaagatgagattgaggcgacagtcaaaagtgcgtatctatcctaa

DBGET integrated database retrieval system