KEGG   Tremella mesenterica: TREMEDRAFT_37716Help
Entry
TREMEDRAFT_37716  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tms  Tremella mesenterica
Pathway
tms00500  Starch and sucrose metabolism
tms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREMEDRAFT_37716
Enzymes [BR:tms01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TREMEDRAFT_37716
Glycosyltransferases [BR:tms01003]
 Polysaccharide
  Storage polysaccharide
   TREMEDRAFT_37716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 18492899
NCBI-ProteinID: XP_007002485
JGI: Treme1_37716
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MPRSVHQPLLFECAWEVANKVGGIYTVIKTKVPVTVKEYGDRYCLIGPLSYKTAPMEVES
EEPEPGTIFADTLAAMRERGVNMIYGRWLIEGAPRVLLFDTGSCYNRMDEWKTDLWNLAG
IPSPPNDHETNESIVFGYLVAWFLGEFSSRETNTAIIAHFHEWQAGVAIPLCRKRHIDVT
TIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCSDVFTTVS
HITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNLHVQSKEKINDFIRGHFYGYYDFD
LDNTLYLFTAGRYEFRNKGVDMFIEALARLNHRLQAMKSNMTVVAFIIMPAATNSYTIEA
LKGQAVTQQLRETVAQVTAKVGKRLFEHAARYTGEHGTEVLPADQLLSSEDKILLKRRVF
ALKRNSLPPVVTHNMADDAGDPILSQIRRVQLFNRPTDRVKIIFHPEFLNSNNPILGLDY
EEFVRGCHLGVFPSYYEPFGYTPAECTVMGIPNVTTNLSGFGCFMEDLLETPEDYGCYIV
DRRGQGVEESVAQLTNQLVAFANKTRRQRINQRNRTERLSELLDWKALGMEYVKARQLAM
RRAYPDSFDDEEPDFSGIQRVGAPLSAPGSPKFRTGMMTPGDYATLTEEMEHLGTQDYMG
GKEWRGVTDDDDENHYPFPLVMKPRHRSDSLGSAISGTQTPHGGRKLSEKDLAQADAALS
HVNGNGNGVNGH
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctctgtccatcaacctctcttatttgaatgtgcctgggaggtagccaacaaa
gttggtggtatctacactgttatcaagaccaaagtccccgtgacagtcaaagaatatgga
gacagatactgtcttatcggacctttgtcttacaagactgcacctatggaggtggaatct
gaagagcccgaaccagggactatattcgcagataccctggctgccatgcgtgaaagaggg
gtcaacatgatctacggcagatggcttatcgaaggagcaccccgagttctactctttgac
actggaagttgctacaataggatggacgaatggaagaccgatttatggaatctcgctgga
attccaagtcctcccaatgatcacgaaaccaacgaatcgatcgtcttcggatatctcgtg
gcttggtttcttggagagttttcctctcgcgaaaccaatacagcaatcatcgctcatttc
cacgagtggcaagcgggtgtcgctatccctctttgcagaaagagacatatcgacgtcact
accattttcacaacccatgcgacgttgttgggtcgatacttgtgtgctggtagtgttgac
ttctacaataatctgcaatactttgatgtggatcatgaagctggtaagagagggatctac
cataggtactgtattgagcgatctgcggcacattgctcagatgtcttcaccacggtgtcc
cacatcacagcttttgagagcgagcatctgttgaagcgtaaacctgacggtgttctgcct
aacggacttaacgttgtcaaatttgcagccatgcacgaattccaaaatctccacgtccaa
tccaaagagaagatcaacgatttcatccggggccatttctacggatactacgacttcgac
ttggataatacactttacttgttcaccgctggtcgttacgagttccgcaataagggtgtc
gacatgttcatcgaagctcttgcccgtctgaatcatcgtctgcaagcgatgaaatcaaac
atgactgtagtggcattcatcatcatgcctgccgctaccaactcttacaccattgaagcc
ctaaagggtcaagcggtgacacaacaacttcgagaaacggttgctcaggtaactgcaaaa
gtcggtaaacggctattcgagcatgccgccaggtacaccggcgagcatggaacagaggta
cttcccgctgatcaactactatctagcgaagacaagatattactcaaacgtcgtgtcttc
gctctaaaacgcaactctcttcctcctgtcgtaacacacaacatggcagatgacgcgggt
gatcccatcctcagtcaaatccgccgagttcagttgttcaaccggcccaccgatcgtgtc
aagatcatcttccatcccgagttcttaaactccaacaaccctattctgggtttagactac
gaagagttcgtgcggggatgtcatctgggtgtcttcccgtcgtactatgaacctttcggc
tataccccagcggaatgtacggtcatgggaattcctaatgtcacgaccaacttgtctggg
tttggttgtttcatggaagatttactggaaactcctgaggattatgggtgttacattgtt
gatcgacgtggtcagggtgtggaggagtcggtagctcagttgactaaccaactcgtcgca
ttcgccaacaaaacccgtcgtcaacgtatcaatcaacgtaaccgtaccgagcgtctgtca
gagttgctcgactggaaagctctaggcatggaatacgtcaaagctcgtcagttggctatg
cgccgcgcttacccagactcgttcgatgatgaggaacctgactttagtgggatccagagg
gtcggggcaccgttgtcggcacctggtagtccgaagttcagaacgggtatgatgacgcct
ggagactatgcgacgttgactgaggagatggaacatttgggaacgcaggattatatgggg
ggtaaggaatggcgaggtgtaaccgacgacgacgacgagaaccattacccgtttccactg
gtcatgaaacctcgtcaccgatccgactctctgggctctgccatttcaggcactcagaca
cctcatggtggacgcaaactgagcgagaaggacttggcccaagccgatgcggcgttgagc
catgtgaacggaaatggtaacggtgtaaacggtcactag

DBGET integrated database retrieval system