KEGG   Trichechus manatus latirostris (Florida manatee): 101345412Help
Entry
101345412         CDS       T05135                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04068  FoxO signaling pathway
tmu04146  Peroxisome
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101345412
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101345412
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    101345412
   04213 Longevity regulating pathway - multiple species
    101345412
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101345412
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101345412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101345412
NCBI-ProteinID: XP_004368859
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGALGSRQKHSLPDLPYDYGALEPYINAQIMQLHHNKHHAAYVN
NLNIAEEKYKEALAKDDVTTQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IVRDFGSFEKFTKKLTAVCVGVQGSGWGWLGFNKERGLLQIAACSNQDPLEGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWKVINWDNVTARYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacgagcaggaagctggtaccagctttgggagctttg
ggctccagacagaagcacagcctgcctgacttgccgtatgattatggcgccctggagccg
tacattaacgctcaaatcatgcagctgcaccacaacaaacaccacgccgcttacgtgaac
aacttaaacatcgctgaggagaagtataaagaggcgctggcaaaggatgatgttacaacc
cagatagctctccagcctgcgctgaagttcaatggcggaggtcacattaatcatagcatc
ttctggacaaacctgagccctaatggcggtggagaacccaaaggggaattgctggaggcc
atcgtacgtgactttggttcctttgagaagtttacgaagaagttgacagctgtgtgtgtt
ggcgttcagggttcaggctggggttggcttggtttcaacaaggaacggggactcttacag
attgccgcttgttctaatcaggacccactggaaggaacaacaggtcttattccactgctg
gggattgatgtgtgggagcatgcttattaccttcagtataaaaatgtcagacctgattac
ttaaaagctatttggaaggtgatcaactgggacaacgtaactgcaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system