KEGG   Trichechus manatus latirostris (Florida manatee): 101348006Help
Entry
101348006         CDS       T05135                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101348006
Enzymes [BR:tmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101348006
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101348006
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101348006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101348006
NCBI-ProteinID: XP_004376927
LinkDB All DBs
Position
Unknown
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPSLGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagcgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgcccttccctgggcatctccaagaggaatctc
tatgattttgaagtcgagtacctgtgtgactacaagaagattcgcgaacaggagtattac
ctggtaaagtggcgtggatacccagactcggagagcacctgggagccacggcagaatctc
aagtgtgtgcgcatcctcaagcagttccacaaggacttagaaagggagctgctccggcga
caccaccggtcaaagccacctcggcacttggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcactgcggcggtgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcactgtggagaatgaggtggacctggatgggcctccgcgggccttt
gtgtacatcaatgagtaccgtgttggtgagggcatcacgctcaaccaggtggctgtgggc
tgcgagtgccaggactgtttgtgggctcctgctggaggctgctgcccgggggcatcactg
cacaagtttgcctacaacgaccagggccaggtgcggctgcgagccgggctgcccatctac
gagtgcaactcacgctgccgctgtggctatgactgccccaatcgtgtagtacagaagggc
attcgctacgacctctgcatcttccgcacagatgatgggcgtggctggggcgtccgcaca
ctggagaagatccgcaagaacagctttgtcatggagtacgtgggagagatcattacctca
gaagaggcggagcggcggggccagatctacgaccgccagggtgccacctacctcttcgac
ctagactatgtggaggatgtgtataccgtggatgccgcctactacggcaacatttcccac
tttgtcaaccacagttgtgaccccaacctgcaggtgtacaatgtcttcatagacaacctt
gatgagcggctgccacgcatcgctttttttgccacaaggaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctccccaaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctaa

DBGET integrated database retrieval system