KEGG   Trichechus manatus latirostris (Florida manatee): 101357935Help
Entry
101357935         CDS       T05135                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase isoform X1
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00730  Thiamine metabolism
tmu00790  Folate biosynthesis
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101357935
   00790 Folate biosynthesis
    101357935
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101357935
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101357935
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmu00537]
 Enzymes
  101357935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101357935
NCBI-ProteinID: XP_004389568
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MPGACIQLLLLGLGLQLSLGVIPAEEENPAFWNQKAAEALDIAKKLQPSQKAAKNLIIFL
GDGMGVSTVTAARILKGQLNGKLGPETPLAMDYFPYLALSKTYSVDRDVPDSASTATAYL
CGVKANYETIGLSAAARYNECNTTHGNEVTSVLSRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRNWYSDADVPAQALKDGCQDIATQLISNTDIDVILGGGRKYMFPTGTPDPEYPDQ
SGVRLDNRSLVQEWLDKHQGARYVWNRTALIQASQDPSVTHLMGLFEPADMKYDAVRNTT
QDPSLTDMTKAALHLLSRNPQGFYLFVEGGRIDHGHHAGNAYMALTEAIEFDNAIEGAGQ
LTNEEDTLTLVTADHSHVFSFGGYTLRGSPILGLANGKASDGKAYTSILYGNGPGYALGS
GSRPDVNESQSTLPDYKQQAAVPLSSETHGGEDVALFARGPQAHLVHGVQEQSFVAHVMA
FAACLEPYTDCGLEPSAGSSGAAPLARPLWTPLLAGALLLLLLVPAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggcctgcatacagctgctgctgctgggcctggggctacagctctcacttggt
gtcatcccagctgaggaggagaacccagccttctggaaccagaaggcagccgaggccctg
gacatcgccaagaagctgcagccttcccagaaggctgccaagaacctcattatcttcctg
ggggatgggatgggggtgtccacggtgacagccgctcggatcttaaaagggcagctgaat
ggcaagctggggcctgagacgcccctggccatggactacttcccgtacctggctctgtcc
aagacgtacagtgtggacagggatgtgccagacagcgcaagcacggccacggcctacctg
tgcggcgtcaaagccaactacgagaccatcggcctgagcgcagccgcccgctataacgag
tgcaacacgacccacggcaatgaggtcacctctgttctgagccgggccaagaaagcaggg
aagtctgtgggggtggtgactaccacgcgggtgcagcacgcctcaccagctggcacatat
gcgcacacggtgaaccggaactggtactcggacgccgacgttcctgcccaggcgctgaag
gacggctgccaggacattgccacacagcttatctccaacacagacattgacgtgatcctt
ggcggaggccggaagtacatgtttcccacggggaccccagatcctgagtacccagaccaa
agcggggtcaggttggacaaccgaagcctggtgcaggagtggctagacaagcaccagggc
gcccgctacgtgtggaaccgcacagcactcatccaggcatcccaggacccctcggttacg
cacctcatgggcctctttgagccagcggacatgaaatatgatgcagtccgaaacaccacc
caggacccctctctgacagacatgaccaaggcagccctgcatctgctgagcaggaatccc
cagggcttctacctctttgtggagggagggcgcatcgaccacggtcaccacgcaggcaat
gcttacatggccctgaccgaagctatcgagtttgacaacgccatcgagggggcgggccag
ctcacaaatgaagaggacactctgaccctcgtcaccgccgaccactcccacgtcttcagt
tttggtggctacacgctacgtgggagccccattcttgggctggcaaatggcaaggcctca
gacggcaaggcctacacctccatcctgtacggcaacgggcccggctacgcgctcggcagc
ggctcccggcccgacgtcaacgagagccagagcacgctccccgactacaagcagcaggcg
gccgtgcccctgtcgtcggagacgcacggcggcgaggacgtggcgttgttcgcgcgcggc
ccgcaggcacacctggtgcacggggtgcaggagcagagcttcgtggcgcacgtcatggcc
ttcgccgcctgcctggagccctacactgactgcggcctggagccctccgccggcagcagc
ggcgccgcgcccctcgcccgcccactgtggacgccgctgctggccggggcgctgctgctg
ctcctgctggtgcccgctgctccctga

DBGET integrated database retrieval system