KEGG   Trichechus manatus latirostris (Florida manatee): 101361430Help
Entry
101361430         CDS       T05135                                 

Definition
(RefSeq) neuroendocrine convertase 2 isoform X1
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101361430
Peptidases [BR:tmu01002]
 Serine Peptidases
  Family S8: subtilisin family
   101361430
Chaperones and folding catalysts [BR:tmu03110]
 Intramolecular chaperones
  Subtilisin family
   101361430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 101361430
NCBI-ProteinID: XP_004376507
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MKGGCVSQWKVVAGLLFYVTVFSSAERPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLALTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGSMVKMAKDWKTVPERFHCVGGSMQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNASRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSTPQRGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggctgtgtctcccagtggaaggtggtcgccgggcttctcttctatgtcacg
gttttttcatctgccgaaagaccggtcttcacgaatcattttctagtggagttgcataaa
gggggagaagaagaagctcgccaagttgcagcagaacacggctttggagtccgaaagctc
ccctttgctgaaggcctgtaccacttttaccacaatggccttgcaaaggccaagagaaga
cgcagcctgcaccacaaacaacagctggagagagatcccagggttaagatggccttgcaa
caggaaggatttgaccgaaaaaagcgagggtatagagacatcaatgagatcgacattaac
atgaacgatcccctttttacaaagcagtggtatctgatcaacaccgggcaagctgacggc
actcctggccttgacttgaatgtggcagaagcctgggagctgggctacacagggaaaggt
gtcaccattggaatcatggatgatgggattgactaccttcatccggacctcgcctccaac
tataatgccaaagcaagttatgacttcagcagcaacgacccctatccatatcctcggtac
acagatgactggtttaacagccatgggacccgatgtgcaggggaggtgtctgctgcagcc
aacaacaatatctgtggggtcggggtggcatacaactccaaggtcgcaggtatccggatg
ctggaccagccctttatgacggacatcatcgaggcttcgtctatcagccacatgccacag
ctaatcgacatctacagtgccagctggggcccgacagacaatgggaagacggtggatggg
ccccgggagctcactctccaggcgatggctgatggtgtgaacaagggccgagggggcaag
ggcagcatctacgtgtgggcctccggcgatggcggcagctacgatgactgtaactgtgat
ggctatgcctccagcatgtggaccatctccatcaactcggccatcaacgatggcaggaca
gcgctgtatgacgagagctgctcctccaccctggcctccaccttcagcaacgggaggaag
cggaaccccgaggccggagtggcaaccacagatttgtatgggaactgcactctgaggcat
tcggggacgtctgcggctgctcccgaggcagccggtgtgtttgcactggctttagaggct
aacctggctttgacctggcgagacatgcagcatctgactgtgctcacctccaagaggaac
cagcttcacgacgaggtccatcagtggcggcggaatggggtcggcctggagtttaatcac
ctctttggctacggggtccttgacgcaggctcgatggtgaaaatggctaaagactggaaa
accgtgcccgagcgatttcactgtgtgggaggctccatgcaggaccctgagaaaatacca
tccactggcaaattggtgctgaccctcacaaccgacgcttgcgaggggaaggaaaatttc
gtccgctacctggagcatgtccaagccgtcatcacagtcaacgccagcaggagaggagac
ttgaacatcaacatgacttccccaatgggcaccaaatccatcttgctgagccggcgccca
agagatgatgactcaaaagtgggctttgacaagtggcccttcatgaccacgcacacttgg
ggggaagacgcccggggaacctggacccttgagctggggtttgtcggcagtacaccccag
agaggggtgctgaaggagtggaccctgatgctccacggcacccagagcgcaccttacatt
gaccaggttgtgagagattaccagtccaagctagccatgtccaagaaggaagagctggag
gaggagctggacgaagctgtggagagaagcctcaagagcatcctaagcaagaactag

DBGET integrated database retrieval system