KEGG   Thauera sp. MZ1T: Tmz1t_1904Help
Entry
Tmz1t_1904        CDS       T00804                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tmz1t_1904
Enzymes [BR:tmz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Tmz1t_1904
Transporters [BR:tmz02000]
 Other Transporters
  Pores ion channels [TC:1]
   Tmz1t_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3 GST_C_2 GST_N_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: ACK54655
JGI: Tmz1t_1904
UniProt: C4ZME1
LinkDB All DBs
Position
complement(2147586..2148191)
Genome map
AA seq 201 aa AA seqDB search
MKLYFKPGACSLSPHIALEESGLPYETESVDLKTKVTASGADFWKSNPKGYVPALLLDSG
ELLTEGAAIVQYIADQAPQKKLAPANGTIERYRLQSWLNFIGTELHKSCSPFFNPASGKE
WKEIAGANLERRLGYVNEQIDGKSYLLGEDFSVADGYLFTVLSWMKFVGIDLAKWPNLSA
FQARVAARPAVQAALKAEGLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacttcaaacccggtgcctgctcgctctcgccccacatcgcgctggaagaa
tccggcctgccctacgagaccgagtcggtcgacctcaagaccaaggtgaccgccagcggc
gccgacttctggaaaagcaaccccaagggctacgtcccggcgctgctgctcgacagcggc
gagctgctcaccgaaggcgcggcgatcgtgcagtacatcgccgaccaggcgccgcagaag
aagctcgcgccggccaacggcacgatcgagcgctaccgcctgcagtcatggctcaacttc
atcggcaccgagctgcacaagtcctgcagccccttcttcaacccggcctcgggcaaggag
tggaaggagatcgccggcgccaacctcgagcgccgcctcggctatgtaaacgagcagatc
gatggcaagtcctacctgctgggcgaggacttcagcgtcgccgacggctatctgttcacc
gtgctgagctggatgaagttcgtcggcatcgacctggcgaagtggcccaacctgagcgcc
tttcaggcccgcgtggcggcgcgtccggcggtacaggcggcgctgaaggcggaaggcctg
gcctga

DBGET integrated database retrieval system