KEGG   Thermotoga neapolitana: CTN_0681Help
Entry
CTN_0681          CDS       T00847                                 

Definition
(GenBank) Pyruvate synthase subunit porA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00020  Citrate cycle (TCA cycle)
tna00620  Pyruvate metabolism
tna00633  Nitrotoluene degradation
tna00640  Propanoate metabolism
tna00650  Butanoate metabolism
tna00680  Methane metabolism
tna01100  Metabolic pathways
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
Module
tna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0681
   00020 Citrate cycle (TCA cycle)
    CTN_0681
   00620 Pyruvate metabolism
    CTN_0681
   00640 Propanoate metabolism
    CTN_0681
   00650 Butanoate metabolism
    CTN_0681
  Energy metabolism
   00680 Methane metabolism
    CTN_0681
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTN_0681
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTN_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACM22857
UniProt: B9K7C4
LinkDB All DBs
Position
complement(683894..685078)
Genome map
AA seq 394 aa AA seqDB search
MKMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGIVKTEMIP
VESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPI
NIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHSDVRLPVMVNLDGFILSHG
VEPVEFYPDDLVKKFVGELKPMYPLLGTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKV
FPEIAKEFEETFGRKYWFVEPYKLDDAEHVMVALGSTNSTIKYVVDELREEGHKVGALKI
WMFRPFPKEQLQELLNGRKSVIVLDRAVSFGAEAPLYEAVKSSLYEVAARPSLGSYVYGL
GGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaaagggtcgttgagagagtggccgtcaccggtgccgaagccgttgccaat
gcgatgagacagatagaacccgacgtcgtcgcggcataccccataactccgcaaactccc
atcgtggagtactttgctagattcgtcgcagacggcatcgtcaaaacagagatgataccc
gttgagagcgaacacagtgcaatgagtgccgttgtgggagctgccgccgcaggcgcaagg
gcgatgacggcaaccagtgcgaacggtcttgctctgatgcatgagatcgtttacattgcc
gcgtcctacagacttcccatagtgatgcccgttgtgaacagggccctgagtggtccgata
aacatacattgtgatcacagtgatgcgatggcagaaagagactcaggctggatacagctc
tttgcagagacaaaccaggaggcttacgatttcaccatccttgccgtgagactcgcagaa
cactccgatgtgagacttcccgtcatggtgaacctcgatggattcatcctctcccacggg
gtggaacccgttgagttttatcctgacgaccttgtgaagaagttcgtcggtgaactgaaa
cccatgtatcctctcctgggcacagaacacccggtaacgtggggacccctcgatctctac
gattactacttcgaacacaaaagacagcaaatagaagccatggaaaacgtgaagaaagtg
tttccggagatcgcaaaagagttcgaagagacgttcggcagaaagtactggttcgtcgaa
ccctacaaactggacgatgcagaacacgtgatggtggccctcggttccacgaacagcacg
ataaaatacgtcgtcgacgaactcagggaagaaggccacaaagttggcgcattgaagata
tggatgttcagaccgttcccgaaggaacaacttcaggagcttctcaacggtagaaagagc
gtcatcgtccttgacagggcagtctcttttggagcggaagcccccctgtatgaggctgtt
aaatcctccctgtacgaagtggccgcaagaccaagccttggatcctacgtttacggtctt
ggtggaagggatataaaaccggagcacatcagaaaggccttcgaggacgccataaacgga
aatctgatcgccgacgaacagagataccttggtctcagagaatga

DBGET integrated database retrieval system