KEGG   Pyrobaculum neutrophilum: Tneu_1038Help
Entry
Tneu_1038         CDS       T00682                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tne  Pyrobaculum neutrophilum
Brite
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tneu_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
926358..926993
Genome map
AA seq 211 aa AA seqDB search
MASVKKYTLPNLPYAYNALEPYIAEEIMRLHHQKHHQGYVNGANAALEKLEKFRKGEAQI
DIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKTADLINKFFGSFEKFKEEFSL
AAKNVEGVGWAILVYEPDQEQLLVLQVEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRG
SYVDNWWNVVNWDDVERRLQKALNGQIALKI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggttaagaaatacacgcttcccaacctgccctatgcctacaacgccctggag
ccctacatcgccgaggagataatgaggctccaccaccagaagcaccaccagggctacgtc
aacggcgcaaacgccgccctcgagaagctggagaagtttaggaagggcgaggcccagata
gacataagggccgtcctcagagacctctccttccacctcaacggccacatactgcactcc
atcttctggcccaacatggcgcccccgggcaagggcggcggcaagccgggcggcaagacc
gccgacctcataaacaagttcttcgggagcttcgagaagttcaaggaggagttcagcctc
gccgccaaaaacgtggagggcgtcggctgggccattctggtatacgagccagaccaggag
cagctcctggtgctacaggtggagaagcacaacctcatgcacgccgcagacgcccaggtc
ctcctggctctagacgtctgggagcacgcctactacctccagtacaagaacgaccgcggt
agctacgtggacaactggtggaacgtggtgaactgggacgacgtggagaggcgcctccag
aaggccttaaacgggcagatcgccctaaagatttaa

DBGET integrated database retrieval system