KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00010753G001Help
Entry
GSTEN00010753G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTEN00010753G001
  Amino acid metabolism
   00310 Lysine degradation
    GSTEN00010753G001
   00380 Tryptophan metabolism
    GSTEN00010753G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GSTEN00010753G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
12
AA seq 1070 aa AA seqDB search
MHRLRTCAARLRPLTASQAAQTVGQQRPAPLTSTGGTRTFQPLRCYSTPVASEPFLNGTS
SNYVEEMYYAWLENPKSVHKSWDVFFRNANAGAPPGAAYQSPLALSAAPRLSSLVGAQPN
VEKLVEDHLAVQSLIRAYQIRGHQVAQLDPLGIMDADLDSCVPTDIITSSDKLGFYGLDE
SDLDKVFRLPTTTFIGGSESALPLKEIIRRLEMSYCQHIGVEFMFINDLEQCQWIRQKFE
TPGVMQFTLEEKRTLLARMVRSTRRCLPGSTSTVCRFEEFLQKKWSAEKRFGLEGCESLI
PALKTIIDKSSEKGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEVTGSQ
RARACVRACMLLTLLLLSQGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVDPV
VQGKTKAEQFYCGDNDGKRVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVN
NQIGFTTDPRVARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCKVAAEWRNTFHKDVVV
DLVCYRRMGHNEMDEPMFTQPLMYKQIKKQKPVLQKYAEKLIAEGAVSRQEYEEEIAKYD
KICEEAYARSKDEKILHIKHWLDSPWPGEQPGLSRRLPVRGFFTLEGQPKSMSCPSTGLT
EDNLNHIGQVASSVPVEDFTIHGGLSRILKARGEMVRNRVVDWALGEYMAFGSLLKEGTH
IRLSGQDVERGTFSHRHHVLHDQNVDKRICIPMNHLAPDQAPYTVCNSSLSEYGVLGFEL
GFAMASPNALILWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPHGCEGMGPEH
SSARPERFLQMCNDDPDVMPVISDDFAVHQLYDCNWIVVNCSTPANYFHVLRRQILLPFR
KPLIIFTPKSLLRHPEARSSFDDMLPGTHFQRLIPEDGAAAQRPEEVKRLIFCTGKVFYE
LIKDRKTREMEASVAISRIEQLSPFPFDQVKAEVDRFPNADLVWCQEEHKNQGYYDYVKP
RIRTTIQRAKPVWYAGREPASAPATGNKNTHLMELRRFSDTAFGLDAFKD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtttaaggacttgcgcggcgcgcttgcgccccctcacggcctctcaggcagct
cagactgttggccaacagcggccagccccgctcacctccacaggtggcacaaggacgttt
cagccgctcaggtgttacagcacacctgtggcctcggagccattcttgaatgggacaagc
tccaattacgtggaggagatgtactatgcctggctggagaacccaaagagtgtccacaag
tcctgggatgtgttctttcgcaacgccaacgccggcgctcctccaggcgctgcctaccag
tctcctctggctctgtctgcagctcctcggctctcctcactggtcggagctcaacccaac
gtggagaagctggtggaggatcatctggcggttcagtctctcatcagggcctatcagatc
cgagggcaccaggtggcccagttggaccctctgggcatcatggatgctgatctggactcc
tgtgttccgactgacatcatcacctcgtcagacaagctgggcttctacggtctggacgag
tctgacctggacaaggtcttccggctgcccacgaccaccttcatcggcggttccgagagc
gccctgccgctgaaagagatcatccgtcggctggagatgtcgtactgccagcacatcggt
gtggagttcatgttcatcaacgatctggagcagtgccagtggatccggcagaagttcgag
actcctggcgtcatgcagttcactctggaggagaaacggacgctgctggcccggatggtc
cgctccaccaggaggtgcctcccgggctcaacgtccactgtgtgcaggttcgaggagttc
ctgcagaagaaatggtctgcagagaagcgcttcggcctggagggctgcgagtctctcatc
ccggcgctgaagaccatcattgataagtcctcagagaagggggtggactacgtcatcatg
gggatgccccacaggggtcgtttgaacgtcctggccaacgtgatcaggaaagagctggag
cagattttctgccagtttgactccaaactggaagctgctgatgaggtaacgggatcccag
cgcgcacgtgcgtgtgtgcgtgcgtgcatgttattgacgctgttgcttctgtcccaggga
tctggggacgtcaagtaccacctggggatgtaccaccggcgcatcaaccgggtgacggac
cgcaacatcacgctgtccctggtggccaacccctcccacctggaggccgtggaccccgtg
gtgcagggcaagaccaaggccgagcagttctactgcggagacaacgacggcaaaagggtc
atgtccatccttctgcacggcgacgctgccttcgcaggacagggcatcgtctacgagacc
ttccacctgtctgacctgccctcctacaccacccacggcactgtgcacgtggtggtcaac
aaccagatcggcttcaccacggacccccgtgtggcgcgctcctcgccctaccccacagac
gtggcccgcgtggtcaacgcgcccatcttccacgtgaacgccgatgacccagaggcggtc
atctacgtgtgcaaggtggcagcggagtggaggaacaccttccacaaggacgtggtggtg
gacctggtgtgctaccggcggatgggccacaacgagatggatgagcccatgttcacgcag
ccgctgatgtacaaacagatcaagaagcagaagcccgtcctccagaagtatgcggagaag
ctgatcgccgagggggccgtcagcaggcaggagtacgaggaggaaatcgccaaatacgac
aagatctgcgaggaggcgtacgctcgctccaaagacgagaagatcctgcacatcaagcac
tggctggactccccctggcctggtgagcagcctggcctcagcagaaggttgcctgtcagg
ggcttcttcactctggagggtcaacccaagtccatgagctgcccatccaccggcctgacg
gaggacaacctcaaccacatcggacaggtggcctcgtctgtccccgtggaggacttcacc
atccacggagggttgagccgtatcctgaaggcccgaggggagatggtccgcaaccgtgtg
gtggactgggctctgggggagtacatggcctttgggtctctgctgaaggaagggacccac
atcaggctgtcgggccaggacgtggagcgaggaaccttcagccaccgccaccacgtcctc
cacgaccagaacgtggacaagaggatctgcatccccatgaaccacctggcccctgaccag
gctccctacaccgtctgcaacagctcgctctcagagtacggcgtcctgggcttcgagctg
ggcttcgccatggccagccccaacgccctcatcctgtgggaggcccagttcggggacttc
cacaacacggcccagtgcatcatcgaccagttcatctgtcccggacaggccaagtgggtg
cggcagaacggcatcgtgctgctgctgccgcacggatgtgagggcatgggcccagaacac
tcctcagcccgtccagaacgcttcctccagatgtgcaacgacgatcctgatgttatgccg
gtgatctcagatgattttgccgtccatcagctgtacgactgtaactggatcgttgtcaac
tgttcaactcctgcaaactattttcatgttctccgacgacagattctccttcctttcagg
aagcctttaatcatcttcacgcccaaatctctgctgcgccaccctgaagctcgctccagc
tttgacgacatgctgcctgggactcacttccagaggctgattccagaggatggagcagct
gcacagcgtccagaagaggtcaagaggctgatcttctgtactggcaaggtgttctatgag
ctgatcaaagacaggaagacgagagagatggaggcaagcgtggccatctctcgcatcgag
cagttgtctccgttcccgtttgaccaggtgaaggcggaggtggatcgtttcccaaacgcc
gacctggtgtggtgtcaggaggagcacaagaaccagggttactacgactacgtcaagcct
cgcatcaggaccaccatccagcgagccaagcctgtctggtatgctggcagggagccggcg
tcggcgcccgccacagggaacaagaacactcatctgatggaactacgacgcttctccgac
accgccttcggcctggacgctttcaaggat

DBGET integrated database retrieval system