KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016397G001Help
Entry
GSTEN00016397G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     GSTEN00016397G001
Peptidases [BR:tng01002]
 Serine Peptidases
  Family S8: subtilisin family
   GSTEN00016397G001
Chaperones and folding catalysts [BR:tng03110]
 Intramolecular chaperones
  Subtilisin family
   GSTEN00016397G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
17
AA seq 640 aa AA seqDB search
MRGSPRHGTAAGWMALLAGLLLSTQPAQGVRTEHLLVQLRGDAQDEAHQLATQHGFQSAR
QLPFGEGLFHFYPQDASKRRNKRSTHRRQELQKDKRVKDVFVQEGFSRQKRGYRNINDIE
VNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLA
SNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGI
RMLDQPFMTDVIEASSISHMPQLIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKDWKTVPERFHCVAGSIQETHK
IQSGSKLVLAINTEACQGKDNFVRYLEHVQAVVTVNASRRGDLSINMTSPMGTKSILLSR
RPRDDDTKVGFDKWPFMTTHTWGEDPRGTWLLEVGFRGKEPQHGVLKEWTLMLHGTQSAP
YIDQIVRDFKSKLAMSKKEELEEELDEAVEKSLKSLLSKN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggtctccccgacacgggacggcggcgggatggatggcgctgctggccgggctg
ctgctctcgacgcagcccgcacagggtgtccgcacggagcatctgctggtccagctgcgc
ggggacgcacaggacgaggcgcaccaacttgcaactcagcacgggtttcagagtgcacga
cagcttcccttcggagaggggctttttcacttttatcctcaggacgcttcaaagaggagg
aataagcgcagcactcacagaaggcaggagctccaaaaagacaaaagggtgaaggatgtc
ttcgtgcaggaggggttcagccgtcagaagcgaggctaccgaaatatcaatgacattgaa
gtcaacatgagcgatcctctgttcactaaacagtggtatttgataaatacaggccaagcg
gatgggacccccgggctggaccttaatgtggcggaagcctggcaactgggctacaccggc
aaaggcgttaccatcgccatcatggatgatggcatcgactatctgcacccagacctggca
tcgaactataatgccgacgccagctatgacttcagcagcaatgacccgtttccatttcca
cgctacacagatgactggttcaacagtcacggcacacgatgtgctggggaggtgtctgca
gcagccaacaacaacatctgtggcgtgggagtcgcgtacaactccaaggtggcaggtatc
agaatgctggatcaacccttcatgactgacgtcattgaggcgtcatccatcagccacatg
ccgcagctcatcgacatttacagcgccagttgggggcccactgatgacggcaagacagtg
gacgggccccgagagctcacactgcaggccatggccgatggtgtcaacaagggacgtgga
ggcaaaggcagcatttatgtgtgggcctctggggatggcggtagctatgatgactgcaac
tgcgatggctacgcttcaagcatgtggacaatctccatcaactcggccatcaacgacggc
cgcacggccctgtacgacgagagctgctcctccaccttggcctccacattcagcaacggc
cgcaagaggaaccccgaggctggagtggccaccacagacctgtacgggaactgcacgctg
cgtcactccggaacctcggcggcagctcccgaggcagccggcgtctttgctctggccctg
gaagctaaccccaatctgacatggagggatatgcagcacttgtccgtcctgacctccaag
aggaaccagctccacgacgaggtacaccagtggaggaggaacggcgtgggtctggagttt
aaccacctgtttggctacggcgtgctggatgctggggggatggtgaaaatggccaaggac
tggaaaacggtgcctgagcgtttccactgcgttgctggatcaattcaggaaacccataaa
atccagtccggcagcaaactggtgctggccatcaacaccgaggcctgccagggcaaggac
aactttgttcgctacctggagcacgtccaggcagtggtcaccgtcaatgccagccgccgc
ggcgacctcagcatcaacatgacctcgcccatgggaacaaaatccatcctgctcagtcga
aggccccgcgacgatgacaccaaggtgggttttgataagtggcccttcatgaccacccac
acctggggcgaggacccccgtgggacctggctcctggaggtgggctttcggggcaaggag
ccacagcatggtgtcctgaaggagtggactctgatgctgcacggaacacaaagtgcccct
tatatagaccagatagtgcgtgattttaagtccaaactggccatgtctaaaaaggaggag
ctagaggaagagctggatgaggctgtggagaaaagtctgaagagcttgctaagtaaaaac

DBGET integrated database retrieval system