KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016908G001Help
Entry
GSTEN00016908G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    GSTEN00016908G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GSTEN00016908G001
Chromosome [BR:tng03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     GSTEN00016908G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-ProteinID: CAF98995
UniProt: Q4SK37
LinkDB All DBs
Position
2
AA seq 1017 aa AA seqDB search
QEQQLQQELVALKHKQQLQRQLLIAEFQRQHEQLSRQHEIQLQEHIKHQQDLLALKHQQE
LLEHQRKIEQQRHEQELEKQQREYKLHQLKNKDRGQESAIASTEVKMRLQEFVLNKKKAL
AQRNLNHCLPTDPRYWYGKTQHSSLDQSSPPQTALSAYTHPMLGTYDAKDDFPLRKTASE
PNLKLRSRLKQKVTERRSSPLLRRKDGPTTTAKKRSLDMADSACNSAPGSGPSSPNNSSS
NIPSENGVTISSSPAEASLLQRLVAREGSVSHLSLYTSPSLPNITLGLPATGPAASVVSG
HQDGDGRLALPALQQGIPLTSPFLPHTHLPSYLTPSPLDREGPGGAAAGSHNPLLQHMVL
LEQGHSPVGLGGLPLPSPSVSKLARGHRPLGRTQSAPLPQQQCGQAQALQQLVVQQQHQQ
FLEKHKQQFQQQQQQQQHIISKIMSKPADQVSAVSSSPSGPARQHQSHPEETEEELREHQ
GLSSSSSSSPSVSVKEAGPIRGVVIKQEPVDPQELEEKEQRERQAEKDFLFRQQALLLEQ
QRIHQLRNYQASMEAAGLPVSFAGHRPLSRAQSSPASASFPIVVPEPSTKLRFTTGLVYD
SLMQKHQCMCGNTTVHPEHAGRIQSIWSRLQETGLRAHCECIRGRKASLEELQTVHSEAH
VLLYGTNPLRQKHDCSVSPMFVMLPCGGIGVDSDTIWNEVHSSTAARLAVGSVAELVFKV
ASGELKNGFAVVRPPGHHAEESAPMGFCYFNSVAIAAKLLQQRLNVRKILIVDWDVHHGN
GTQQAFYADPGILYISLHRYDDGNFFPGSGAPDEVGSGPGAGFNVNMAFTGGLEPPMGDV
EYLAAFRTVVMPIANEFAPDVVLVSSGFDAVDGHASPLGGYKLTAKCFGYLTRQLMALAE
GRLVLALEGGHDLTAICDASEACVSALLGNELEPIPDEVMRQRPNANAVRSMEKVVGAHS
KYWRSLQRSASTLACSLSERLQRDTEEAETVSAMASLSVANKHMGKRCEEEPMEEEA
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
caggagcagcagctgcagcaggagctggtggctctcaaacacaagcagcagctgcagagg
cagctactcatcgccgagttccagaggcagcacgaacagctgtcacgccaacatgagatc
cagctgcaggagcacatcaagcaccaacaggacttactggcactcaagcaccaacaggag
ctgctggagcaccagaggaagattgagcagcagcgtcatgaacaggagctggagaagcag
cagcgggagtacaaactccatcagctcaagaacaaggacaggggacaggagagtgccatc
gccagtacggaggttaagatgcgacttcaggaatttgtgctgaacaagaaaaaagccctg
gctcagcgaaacctaaaccactgtctgcccactgacccgcgctattggtatggaaaaacc
cagcacagttctctggaccagagctctccgccccaaacagctctgtcagcatacacccac
ccgatgctgggcacgtacgacgcaaaggatgacttccctctccgcaaaacagcatccgag
cccaacctgaagcttcgctcccggctaaagcagaaggtgacggagcggcgcagtagccct
ctgcttcggagaaaagatgggcccaccaccactgccaagaagcgatctctggacatggct
gactctgcttgcaacagcgctccaggctcaggtcccagctctcccaacaacagctccagt
aacatccccagtgagaacggggtcaccatttccagcagccccgcagaggcctctctgctt
cagaggttggtggcgagggaaggttcagtcagccacctctccctgtacacctccccctcg
ctgcccaacatcaccctgggactgccagccaccggtcctgctgccagcgtggtgtcggga
caccaagatggcgacggtcgcctggcgttacctgcgctgcaacaaggaattcctctaacc
tctcccttcctgccccacacccacctgccctcttatttaacaccctcgcctctagacaga
gaggggcccggaggggctgctgccggctcccacaaccctctcctgcagcacatggtgctg
ctggagcagggtcacagtccagtgggcctggggggcctcccactaccatcgccttccgtc
tctaagctggcacggggccaccgtcctctgggaaggacccagtcggcccctctgccccag
cagcagtgcggccaggcccaggccctgcagcagctggtggtccagcagcagcaccagcag
ttcctggagaaacacaagcagcagttccagcagcagcagcagcagcagcagcacatcatc
agcaagatcatgtccaagcctgccgaccaggtctcggccgtgagctccagcccctcggga
ccggcccggcaacaccagagtcaccccgaggaaacggaagaggagctcagagaacaccag
gggctctcctcttcctcgtcctcgtcgccgtcggtgtccgtgaaggaggcggggcctata
agaggggtggtcataaaacaggaacctgtggaccctcaagagctggaggagaaggagcag
agagagagacaggccgagaaggacttcctctttagacagcaggctctgctgttggagcag
cagcggatccaccagctgaggaactaccaggcctctatggaagcagctggtttgccggta
agcttcgccgggcatcggcccctgtccagggcccagtcttctccagcctccgcttccttc
cccatcgtagtgcccgagccctccaccaagcttcggtttaccacaggtctggtttacgat
tccctgatgcagaagcatcagtgcatgtgcggcaacaccaccgttcatccggagcacgct
ggccgcattcagagcatctggtcccggcttcaggaaacgggtctccgggctcactgtgag
tgcatccggggcagaaaggcttctctggaggagctgcagacggtccactccgaagcccac
gtccttctgtacggaacaaacccactgcggcagaaacacgactgttccgtgagtcccatg
tttgtgatgttaccatgtggaggcatcggggtggacagcgacaccatctggaacgaagtc
cattcgtccaccgcggctcgcctggccgtggggtcggtggccgagctcgtttttaaagtg
gcatcgggcgaactgaagaacggtttcgctgttgtccgaccgcctggacatcacgccgag
gagagcgcgccgatggggttctgttacttcaactcggttgccatagcagccaagctcctg
cagcagaggctgaacgtcaggaaaatcctcatcgtggactgggatgttcaccatggcaac
ggcacccagcaggcgttctacgcagacccagggattctctacatttcactgcatcgctac
gacgatggcaacttcttccccggcagcggagcgccggacgaggtgggcagcggaccgggt
gcgggcttcaacgtgaacatggcctttacaggaggactggaaccccccatgggtgacgtc
gagtacctggctgcttttaggacggtggtgatgccgattgctaacgagtttgcgccagac
gtggttctggtatcttcgggctttgatgcggtggacggccatgcctcgccactgggagga
tacaaactaacagcgaaatgctttggctacctgaccaggcagctgatggctctggcagaa
gggaggctggttctggccctggagggcggtcacgacctcacagccatatgcgacgcttcc
gaagcctgcgtctccgctctgctcggcaacgagctggagcccattcctgacgaggtgatg
cggcagaggccgaacgcgaacgccgtccgctccatggagaaagttgtgggagctcacagc
aaatattggcgctcgctgcagcgctccgcctccacgctcgcttgctccctgagcgaacgc
cttcagcgcgacacagaggaggctgaaaccgtctctgctatggcctcgttgtccgtggcc
aacaagcacatggggaaaaggtgtgaggaggaaccaatggaagaggaagca

DBGET integrated database retrieval system