KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018898G001Help
Entry
GSTEN00018898G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:tng00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GSTEN00018898G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GSTEN00018898G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 176 aa AA seqDB search
MFGFPASAVLPCVSFLEVTTAKMVIKAVCVLKGAGETSGTVYFEQQDEKAPVKLTGEIKG
LTAGEHGFHVHAFGDNTNGCISAGPHYNPHNKTHAGPNDENRHVGDLGNVTAEADQIAKI
DITDSVISLHGKFSIIGRTMVIHEKADDLGKGGNEESLKTGNAGGRLACGVIGITQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttttccagcaagcgcagtattgccgtgtgtgtcgtttcttgaagtgacaact
gcgaagatggtgataaaagctgtttgcgtgttaaaaggagccggggagaccagcggaacg
gtttattttgagcagcaggatgaaaaggctcctgtcaagttgacgggggagattaaaggg
ctgaccgctggtgaacacgggttccatgtccacgcttttggagacaataccaatggttgc
atcagtgcaggccctcactacaatccccacaacaagacccatgctgggcctaacgatgaa
aacaggcacgttggagacctgggaaatgtgaccgctgaagcagaccagatcgccaagatt
gacataaccgattcagtaataagcctccatggcaagttttctataattggcagaaccatg
gtgatccacgagaaggccgatgacctgggaaaaggaggcaacgaagagagccttaaaaca
ggaaacgctggtgggcgtttggcctgtggagtcatcggcatcactcagtaa

DBGET integrated database retrieval system