KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019048G001Help
Entry
GSTEN00019048G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:tng00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00019048G001
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    GSTEN00019048G001
   04114 Oocyte meiosis
    GSTEN00019048G001
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00019048G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     GSTEN00019048G001
Chromosome [BR:tng03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    GSTEN00019048G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 573 aa AA seqDB search
MAALCSEFGDLVQIKKQLIAVICLCKERGLLQSAKWASELAFALAPLPKDELPPSPPFTE
EDAQDLDALTLAKSYFDLKEYDRAAYFLKGCCSQKSYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVQNEALRELRVELSKKHIAGELDGFTLYLTAWYLRKLDLIKEAVEVFVEAIHA
LPLHWGAWLELGNLVTNNEMLKSLSLPDCWIKDFFMAHMYTELQMIKEALQKYQNLIEAG
FSKSTYIISQIAVAYHNIRDIDQALAMFNELRDQDPYRIDNMDTFSNLLYVKSMKPELSY
LAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILRMPFYCLYYYRKAHQLRPNDSRMLVA
LGESYEKLSQQAEAKKCYWRAYSVGDVEKMALLKLAKLHEQLNESDDAAQCYMLYIQDIF
SCGEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISQVRD
QIETPSADLFAPLSNNNTPVRRVSPLNLISFTP
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctctgtagtgagtttggagatttggtgcaaattaaaaaacagcttatagca
gtaatatgtctttgtaaggaaagaggacttttacagagcgcaaaatgggcgtctgaactg
gcatttgctctggcaccacttccaaaggatgaattacccccatcgcctccctttactgag
gaagatgctcaagacctggacgcactaacgttggccaagtcctactttgacctgaaggaa
tatgatcgggctgcttatttcctgaaaggctgctgcagtcagaagtcttatttcctatac
atgtattcacgttacctgtcaggtgagaaaaagaaagatgatgagactgtggacagcctg
ggtcctctggagaagggtcaggtacaaaatgaagctttgcgggaactgagggtggagctg
agtaagaagcacatcgctggagagttggatggcttcaccttgtaccttacggcgtggtac
ttgcgaaagcttgacttgatcaaagaggcagtggaggtgtttgttgaggcgattcacgca
cttcctcttcactggggagcctggctggagcttgggaaccttgtcactaacaatgaaatg
ctgaagtccctgtcactgccagactgctggattaaggacttcttcatggctcacatgtac
acagagttacaaatgatcaaagaagctctgcagaaataccagaacctgatcgaagctggc
ttctccaagagcacctacatcatctctcagattgctgttgcctaccacaatatcagagat
attgaccaagccttggctatgttcaacgagctgagggatcaggatccgtatcgaatcgac
aacatggacacgttttccaacctgctgtacgtcaaaagcatgaaaccagagttgagctac
ttggctcacaacctcgtggagatcgataagtacagagtggagacatgctgcgtcattggc
aactattacagtttacgctcccagcatgagaaggcagctctgtacttccagcgggccctt
aaactcaaccctcgctgcctgggcgcgtggaccctgatgggccacgagtacatggagatg
aagaacacttcagcggccatccaagcctacagacatgccatcgaggtgaacaagcgtgac
taccgtgcctggtatggcctgggtcaaacatatgagatcctcaggatgcccttttactgt
ctgtattattatcgaaaggctcaccagcttagacccaatgactcgcgcatgttggtggct
ctgggtgaaagctatgaaaagctgtcacaacaagccgaggcaaagaagtgttactggagg
gcatactctgttggagacgtagagaagatggctctgctcaaactggcaaaactccacgaa
cagctgaacgagtctgatgatgctgctcagtgttacatgctttacatacaagacatcttt
tcctgcggggagcagctggagcatgctgaggtgagcacagctctgcggtacctgggtcag
tactatttcaagaacaagctctacgatgaggcgtccctctgcgctcagcgatgttgtgac
tacaacgatgctcgagaagagggaaaagccctgttgaggcagatctcacaagttagagat
cagattgaaacaccatcagcggacctgtttgctccgctgtccaacaacaacactcccgtc
aggagggtgtctccactcaacctcatctctttcactccc

DBGET integrated database retrieval system