KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020127G001Help
Entry
GSTEN00020127G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     GSTEN00020127G001
Mitochondrial biogenesis [BR:tng03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    GSTEN00020127G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N
Motif
Other DBs
NCBI-ProteinID: CAG01374
UniProt: Q4SDA8
LinkDB All DBs
Position
1
AA seq 810 aa AA seqDB search
RELLADQRAHWQKILLQAFRDSKMILANTSTKDYRLNLYPYLCLLKDGEYIDIMIQSVAT
LPPSGESLKILARDLGSRVYTKYSVRQKHQNQMLDKLSAIYNKYTRVLAKDTKECENLPR
EQWCKLETEQRSGPSLQGGESHWPYIVTLELGTYMVDLMVKNLKINSDILNPAHDRKLIP
VLYHMYAFRSTRQIGFIKPHPILSQMQQEAMETKLTFDSYVMPMLCPPVPWTSVRFGAYL
LTPTKLMRTVEGAMQHDVLLEKCQNLHPVLDSLNQLGNCAWKINKPVLDIIISIFNDRGS
EKLDIPPPLTEAPRIPHFNPHDPNYTASEKALMKRQVMSAKKKYSEMHSLRMDALYKLSI
AHHMRDEIFWFPHNMDFRGRTYPCPPYFNHLGSDVTRATLLFAEGKPLGAKGLDWLKIHL
VNLTGLKKRSSLQGRLEYADTIMEDILDSADNPLKGKKWWMNADEPWQALSCCMEIANAV
RAPDSTQFISHFPVHQDGSCNGLQHYAALGRDVIGATSVNLMPCEVPQDVYSGVAQQVEE
LRARDAKSGLKIAQVLEGFISRKVVKQTVMTVVYGVTRYGGRLQIEKRLKEIDEFPKEHV
WDASHYLVRLVFSGLKEMFTGTREIQDWLTESARLISKSGHTVEWVTPLGLPIIQPYHRT
RNQVVSHVWGCSLPVHCSKAVLRPDTVKQKNAFPPNFIHSLDSTHMMLTALHCYSAGLTF
VSVHDCFWTHALTVDTMNKVCREQFVALHSQPILQELSNFLLRKYCTSLPSEARNKKYQE
CRRLMLLLAKVPQTGDFDLQRVKESTYFFS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
agggagttgctggcagatcagcgggcacattggcagaagattctcctacaagcctttaga
gacagtaagatgatcctggctaacaccagcaccaaggactacaggctcaacctctatccc
tatctgtgtctgctgaaggatggcgagtacattgacatcatgatacagagtgttgccacc
ttgcctcctagcggtgaatcgctgaagattttagccagggacctgggcagcagagtctac
acaaagtactctgtccgtcagaagcatcagaatcaaatgttggataagttaagcgccatt
tacaataaatacacaagagtgctggcaaaagacaccaaggagtgtgaaaaccttcccagg
gagcagtggtgcaaacttgagacggagcaaaggtccggaccatcgctgcaggggggagaa
tcccactggccctatatagtaaccctggaactgggaacgtacatggtggatctgatggtg
aagaaccttaaaattaacagcgacatcctgaatccagcccatgacaggaagctcatccca
gtcctctatcacatgtacgccttccgaagcacgcgacagattggcttcatcaagccacac
ccgatcctgtctcagatgcagcaggaggccatggagaccaaattgacctttgactcctac
gtgatgccaatgttgtgcccgccagtgccctggacctctgtcaggtttggagcctaccta
ctgacacctaccaagctgatgcgcacggtggaaggggccatgcaacatgacgtgctgcta
gagaagtgccaaaatctgcatcccgtactggactctttgaaccagcttggaaactgcgct
tggaagatcaacaaacccgtgttggatattattatttctattttcaatgatcggggaagc
gaaaaactagatatccctcctcccctgacagaggcccctagaattccccactttaaccca
catgatcccaattacactgcatccgagaaagctctgatgaagaggcaggttatgagtgcc
aaaaagaagtacagtgagatgcacagcctgcggatggatgcgctgtataaactctccatt
gcacaccacatgagggatgagattttctggtttccccataacatggacttccggggtcga
acctatccctgccctccatactttaaccatttgggaagcgacgtcacaagagccaccctg
ctatttgcggagggaaagcctttgggcgctaagggcttggactggcttaagatccacctg
gtcaatttgacaggactgaagaagaggagctcattacagggacggctggaatatgcagac
accatcatggaggatatattagactctgctgacaaccctcttaaaggtaagaagtggtgg
atgaatgcagatgagccatggcaagctctgtcctgctgcatggagatagcaaacgctgtg
agagctccagattccacacaattcatctcacattttcccgttcaccaggacggctcctgt
aatggtctgcagcactatgcagctctgggcagagacgttattggtgccacatcagtcaat
ctcatgccctgcgaggtgccccaggatgtgtacagcggagtagcacaacaggtggaagag
ttgcgggcgcgtgatgccaagagtggcctgaagatagctcaggtcctggagggcttcatc
agcaggaaggtggtcaaacagaccgttatgactgtcgtgtatggggtcacacgctatgga
ggacgccttcagatagagaaacgactgaaggagatcgatgagttccccaaggagcatgta
tgggatgcatctcattatctagtacgcctggtcttcagcggtctaaaggagatgttcaca
gggaccagagaaatacaggattggctgacagagagcgccaggctcatctccaagtctggc
cacactgtggagtgggtgacacccctgggtttacccatcattcagccataccaccgcaca
cgcaaccaagtggtaagtcacgtgtgggggtgttctcttcctgtccattgtagcaaagct
gttttgaggccagacacagttaaacagaagaacgctttcccaccaaacttcatccactca
ctggactccacccacatgatgctgactgctctccactgttatagtgccggcttgaccttt
gtctctgtgcacgattgcttctggacccacgctctcactgtggacaccatgaacaaggtc
tgtcgggaacagtttgtggctctgcacagtcagccaatccttcaagagctctccaacttt
ctcctgaggaagtactgcactagcctcccctctgaggccagaaacaagaagtaccaggag
tgccggagactgatgctgctgctggccaaagtgccccagacaggtgatttcgatctccag
cgggtgaaagaatccacttatttcttcagctga

DBGET integrated database retrieval system