KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00023367G001Help
Entry
GSTEN00023367G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00023367G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     GSTEN00023367G001
Peptidases [BR:tng01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   GSTEN00023367G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00023367G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 228 aa AA seqDB search
GQERIVGGYAPVPHSIKYIVSIQTTQRQHICGGSLINKYWVVTAAHCNVGLNQMMVVAGD
YSLAIYEGTEQEILPQMLVPHPQYNTTTNNNDIMLIKLKAPVFLNSYVSIALLPRQDASV
AEGRMCRVSGWGYTSPSTGEIPSTLRTVTLPVVSTQVCNSSASYNGSITENMICAGYGTG
GKDACKGDSGGPLVCEGRVYGLVSWGEGCADPSFPGVYTAVSRYRRWI
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ggtcaggagcgtatcgtgggaggctacgcccccgttcctcactccatcaagtacatcgtg
tccattcagacaacgcagcggcagcacatctgcggcggctccttgatcaacaagtactgg
gtggtgaccgccgcccactgcaacgtggggttaaaccagatgatggtggtggcgggagat
tactcgctagccatctacgagggcacagaacaggagatactgccccagatgttggtgccc
cacccacagtacaacaccaccaccaacaacaacgacatcatgctgataaagctgaaggcg
cccgtcttcctgaacagctacgtctccatcgctctgctgccccgccaggacgcctccgta
gcagagggcagaatgtgccgggtgtcggggtggggctacaccagccccagcacgggggag
atcccctccaccctccgcaccgtcacgctgcccgtggtctccacgcaggtgtgcaacagc
agcgcctcctacaacggaagcatcaccgaaaacatgatctgcgctggttacggcaccggc
ggcaaagacgcctgcaagggggactctgggggcccgctggtgtgcgagggccgcgtctac
ggcctggtgtcctggggggagggctgcgctgacccgagcttccctggagtctacacggcc
gtgtccaggtaccgtcggtggatc

DBGET integrated database retrieval system