KEGG   Thioalkalivibrio nitratireducens: TVNIR_2992Help
Entry
TVNIR_2992        CDS       T02408                                 

Gene name
cbbL_[H]
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_2992 (cbbL_[H])
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TVNIR_2992 (cbbL_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TVNIR_2992 (cbbL_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3080498..3081913)
Genome map
AA seq 471 aa AA seqDB search
MAVKTYEAGVKEYREKYWTPDYVPLDTDLLACFKVTGQPGVPREEVAAAVAAESSTGTWS
TVWSELLTDLEYYKGRAYRIEDVPGDKESFYAFVAYPLDLFEEGSIVNVLTSLVGNVFGF
KALKHLRLEDIRFPIAYIKTCMGPPSGIQVERDKLNKYGRPMLGATIKPKLGLSAKNYGR
AVYECLRGGLDLTKDDENVNSQPFMRWQNRFEFVAEAVMKAQAETGERKGHYLNVTAPDP
EQMYERAEFAKELGMPIVMHDFLTGGFTANTGLAKWCRKNGILLHIHRAMHAVIDRHPKH
GIHFRVLAKCLRLSGGDHLHTGTVVGKLEGDRNSTLGFVDQLREAFVPEDRARGVFFDQD
WGSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTQGHPWGNAAGAAANRVALEAC
VKARNEGRELEREAREILTDAARHSPELAIAMETWKEIKFEFETVDKLDVG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcagttaagacctatgaagccggtgtcaaggaataccgggaaaagtattggaccccg
gactatgtcccgctcgacactgacctgctggcctgtttcaaggtcaccggtcagcccggt
gtcccccgcgaagaggtggccgcagccgtggccgcggaaagctcgaccggcacctggagc
accgtgtggtccgagctgctgaccgacctcgaatactacaagggccgtgcctaccgcatc
gaggacgtgcctggcgacaaggaatcgttctacgcgttcgtggcctacccgctcgatctg
ttcgaggaaggctcgatcgtgaacgtgctgacctcgctggtcggcaacgtcttcggcttc
aaggcgctgaagcacctgcgtctggaagacatccgcttcccgatcgcctacatcaagacc
tgcatgggcccgcccagcggcatccaggtcgagcgtgacaagctgaacaagtacggccgc
ccgatgctcggcgcgacgatcaagccgaagctcggtctgtccgcgaagaactacggccgt
gcggtgtacgagtgtctgcgcggcggtctcgacctgaccaaggacgacgagaacgtcaac
tcgcagccgttcatgcgctggcagaaccgtttcgagtttgtcgccgaggcggtgatgaag
gcgcaggccgagaccggcgagcgcaagggccactatctgaacgtgaccgccccggacccc
gagcagatgtacgaacgcgccgagttcgcgaaggaactgggcatgccgatcgtcatgcac
gacttcctgaccggggggttcaccgcaaacaccggtctggccaagtggtgccgcaagaac
ggcattctgctgcacatccaccgcgcgatgcacgcggttatcgaccgtcatccgaagcac
ggcatccatttccgcgtgctggccaagtgcctgcgcctgtccggcggtgaccacctgcac
accggaaccgtggtcggcaagctcgagggcgaccgcaattccacgctgggtttcgtcgac
cagcttcgcgaagcattcgtgccggaagaccgcgcccgcggcgtgttcttcgaccaggac
tggggctcgatgcctggtgtgttcgcggtggcgtctggcggtatccacgtctggcacatg
ccggcactggttgcgatcttcggcgatgattcggtgctgcagttcggtggcggcacgcag
ggccatccctggggcaacgccgcgggtgccgccgccaaccgcgtcgcgctcgaggcctgc
gtgaaggcgcgcaacgagggtcgtgagctcgagcgcgaggcgcgcgagatcctgaccgat
gccgcccgccacagcccggaactcgcgatcgcgatggaaacctggaaagagatcaagttc
gagttcgagaccgtggacaagctggacgtcggctga

DBGET integrated database retrieval system