KEGG   Thermococcus nautili: BD01_0070Help
Entry
BD01_0070         CDS       T03065                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tnu  Thermococcus nautili
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tnu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BD01_0070
Enzymes [BR:tnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BD01_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(51691..53178)
Genome map
AA seq 495 aa AA seqDB search
MKTKVAIIGAGISGASIARVLSRYENLEVHLIEKAPDVGWGVSKANTALIHGGYDDDPEK
YPTRARLCIRGNRLWHQWVKELEIPHVWNGTLIVATKDEDFDELERLLERGRKNGVPEMR
LVDKEELFHLEPNLTREAIGALWVPIVGQIGPIPAVIAITENAVANGVKTHLETEVTGIK
VENGEVRGVETKDGFIEADIVINAAGLYADKIARMVGIDYFEIHPRKGEYWIFDDDVPGP
KRVLFPTPTPISKGIVVTTEISGHLMIGPNAQDLPPEEKENLATTKEGLEQVWEGAKKLW
PQLPPRSKVIRTFAGLRPEPTGGDFIIKAEEEVWGFINVAGIRSPGLTSAPAIAYEVAEI
IERDLGIELKEKEKWNPYRKEISHFFMMTPEQVNEAVKKNPSYGKIVCRCNNVSEGDILE
AIERMKFIGVKTPSVDSVKFRTKATTGTCQGSFCRPKIVQLLAKEYGVEPWEVTLKGKGS
EIGIGDVKVLLRGDA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaagtcgctataataggggcaggaattagcggggcgagcatagcgagggtt
ctcagcaggtacgagaacctcgaagtccacctgatagaaaaagctcctgatgttggctgg
ggagtgagcaaggccaacacggctctgattcacggcggctacgacgacgaccccgagaag
tacccgacgagggccaggctgtgcataaggggaaacaggctctggcaccagtgggtcaag
gagcttgagattccgcacgtctggaacgggacattgatagtcgcgacgaaggatgaggac
ttcgacgagctcgagaggcttttggagcgcggaaggaagaacggcgttccggagatgagg
ctcgttgataaggaagagctcttccaccttgaacccaacctcacgagggaagcgattgga
gctttatgggttccaatagtgggccagattgggccgattccggccgttatcgcgataacc
gagaacgccgttgcgaatggcgtgaaaacgcacctcgagacggaggtcactggaataaag
gtcgagaacggtgaggtcaggggcgttgagacgaaggacggcttcatcgaggcggacatc
gttatcaatgcagcgggtctttacgcggacaaaatagcgagaatggtgggtatagactac
ttcgaaatccacccgaggaaaggtgagtactggatttttgacgacgacgttcccgggccg
aagcgcgtcctcttcccgacgccgacgccgataagcaagggaatagttgtaaccaccgag
atttccggccatctgatgatagggccgaacgcccaggacttaccgccggaggagaaagaa
aacctcgccacgaccaaggagggccttgagcaggtctgggaaggggccaagaagctctgg
ccgcagctgcccccgaggagcaaggtaatcaggacctttgcaggtctaaggcccgagccg
acgggaggggacttcataatcaaggcggaggaagaggtctggggcttcatcaacgtcgct
ggaatacgctcacctggcctgacgagcgccccggcgatagcctacgaggttgccgagata
atcgagcgcgaccttggaatcgagctgaaggaaaaggagaagtggaacccctacaggaag
gaaatcagccacttcttcatgatgacgcccgagcaggtgaacgaagccgtaaagaagaat
ccatcctatggaaagatagtctgcaggtgcaacaacgtcagcgagggcgacatccttgag
gccatagagagaatgaagttcataggcgttaaaacgccgagcgttgattccgtcaagttc
agaaccaaagctacaacgggaacctgccagggaagcttctgcaggccgaagattgtccag
cttttggcgaaggaatacggagtcgagccgtgggaagttacgctgaagggtaagggaagc
gagattggaataggagacgtcaaggttctcctcaggggggatgcctga

DBGET integrated database retrieval system