KEGG   Thermus oshimai: Theos_0764Help
Entry
Theos_0764        CDS       T02346                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
tos  Thermus oshimai
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theos_0764
   00620 Pyruvate metabolism
    Theos_0764
   00630 Glyoxylate and dicarboxylate metabolism
    Theos_0764
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Theos_0764
   00680 Methane metabolism
    Theos_0764
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Theos_0764
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Theos_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(703753..704736)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPIVLQLLEIPQAMKALEGVIMELEDC
AFPLLAGIEASDDPKVAFRDADYALLVGAAPRKAGMERRDLLEMNGRIFTEQGRALAEVA
KREVKVLVVGNPANTNALIAYKNAEGLDPRNFTAMTRLDHNRAKAQLSKKTGVPVDRIRK
LAVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDFVSMAVPSRGEYGIPEDIVYSFPVTAKDGVYTVVEGLEIT
PFARERMEITARELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcccgtacgcgtagcggtgaccggtgccgcaggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccaacccatcgtcctccagctt
ctggaaatcccccaggccatgaaggccctggaaggggtcatcatggagctggaggactgc
gccttccccctcctcgcggggatagaggccagcgacgaccccaaggtggcctttagggat
gcggactacgcccttttggtgggggccgcccccaggaaggcggggatggaacggcgggac
ctcctggagatgaacggccgcatcttcaccgagcagggccgggccctggcggaggtggcc
aagcgggaggtgaaggtgctggtggtgggcaaccccgccaacaccaacgccctaatcgcc
tacaagaacgcggaagggctggacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccaactctccaagaagaccggggtcccggtggaccgcatccggaag
cttgcggtctgggggaaccactcctccaccatgttccccgacctcttccacgcggaggtg
gacgggaggcccgccttagagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggcctccagcgcggccagc
gccgccaacgccgccatcgagcacatccgggactgggccctagggaccccggagggggac
ttcgtctccatggccgtgccctcgaggggggagtacggcatccccgaggacatcgtctac
tccttccccgtcaccgccaaggacggggtgtacacggtggtggagggcctggagatcacc
cccttcgcccgggaaaggatggagatcaccgcccgggagcttctggacgagatggagcag
gtgaaggccctgggcctcatctaa

DBGET integrated database retrieval system