KEGG   Treponema putidum: JO40_09715Help
Entry
JO40_09715        CDS       T03278                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tpk  Treponema putidum
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpk00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    JO40_09715
Enzymes [BR:tpk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     JO40_09715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2028695..2029996
Genome map
AA seq 433 aa AA seqDB search
MKKKVYLGLTGDIIHPGIINIINEGKKYGHLIIGLLTDTAIVSHKRLPYLSYEQRKQVVE
NIKGVSEVIPQEDWSYIPNLKKLKPDFIIHGDDWKSGSLSKIRDEVIEVMKEWGGEVIEV
PYTKGINSSALASNMHSIGTTPEVRMKTLRRLIEAKPIVRIMEAHSGLSGLIIENLEVQK
DDGVHRYDGMWSSSLTDSTSKGKPDIEAVDLTTRLQSLTDILECTTKPIIYDGDTGGKTE
HFVFTVRTLERNGVSAIIIEDKVGLKKNSLFGTEAKQELASVEDFCHKISEGKKAQVTKD
FMIIARLESLIAGHSVDEALERAFAYVKAGADGVMIHSKEKHGNDIKEFCERFRKEYEKV
PIVLVPTTYNQFTEKELAAWGANIIIYANHMLRASYPAMLKAAKTILEAERSLEVNDMCL
SIKQILELIPGTK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtttatcttggacttactggagatattattcatccggggattatcaac
attatcaatgaaggtaaaaaatatggacatcttataataggtctattaaccgatacggca
attgtttcgcataagagacttccgtatctctcttatgaacagcgtaaacaggttgttgaa
aacattaagggtgtaagcgaagtcattcctcaggaggattggtcttatattccgaactta
aaaaaacttaagcctgattttattattcacggtgatgattggaaaagcggctctttaagt
aagattcgggatgaggttatcgaagtgatgaaagagtggggcggcgaggttattgaagtt
ccttatactaagggaattaattcaagcgctcttgcttcaaatatgcacagcatcggtacc
acccctgaagtcagaatgaaaaccttgcggcgtcttattgaagctaagccgatagttcgc
ataatggaagctcattcaggcctttccggacttattatagaaaatcttgaagtacaaaaa
gatgacggtgttcatcgttatgacggaatgtggtcttccagcttgacagactccaccagt
aaaggaaaaccggacatagaagctgttgatcttacaacccgtttgcaaagtttaactgat
attcttgaatgtactaccaagcctattatttatgatggagacacaggggggaaaacagag
cactttgtgtttactgtacggacccttgagcgcaatggtgtttccgccatcataattgaa
gataaggttggcttgaagaaaaacagtcttttcggcacggaagcaaaacaggaattagca
tctgttgaagatttttgtcataaaatttccgaaggaaaaaaagcacaagttacaaaagac
tttatgataatagcccgtcttgagtctcttatagccggacattccgtcgacgaagcattg
gagcgtgcttttgcctatgtaaaagccggtgccgacggcgttatgattcatagtaaagaa
aaacacggaaacgatataaaagagttttgtgaacgctttagaaaagaatatgagaaggtt
cccatagtcttagttcctacgacttataatcagtttaccgaaaaggaattggctgcatgg
ggtgcaaacataatcatctatgccaaccacatgctgcgtgcttcatatcctgcaatgctc
aaagcggcaaaaactattttagaggctgagcgttcattggaagtaaatgacatgtgcctt
tcgattaaacaaattttggaacttattccggggactaaataa

DBGET integrated database retrieval system