KEGG   Thermococcus profundus: A3L09_03550Help
Entry
A3L09_03550       CDS       T05153                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tprf  Thermococcus profundus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tprf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L09_03550
Enzymes [BR:tprf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L09_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
631624..633579
Genome map
AA seq 651 aa AA seqDB search
MSTTTGTEESYALFIDLDREKAVRKRLAPSEVKAYLGGRGFNSRKLFEMVNGKIDPLGPE
NVLALGNGTFAGTVLPMTSRLHVSTISPLSGILGDGNAGGEFAAMMRYAGYDQIVVLGRA
DKPKYVWIEDETVEFRDAEGLWGMKTGELVDVLRDEHGDDVSVAGIGPAGENLVRFATTM
VDKYHAGARGSGAVWGSKNLKAIAIRGTKGVEPADPETFYGLAKEDLEYFKRSEFVRKIY
SVIGTHYGLLSWHPGWRYFSKYLGPDELPKGLRPEDLAAYEVGRTQCYSCPLACKDVYYL
PKTGEYGTSSEFESIYALGSNNCITDTEAVLQMEHMADEYGMDVITLGDTIALARLLHER
GILSDEVLDGVSLEWGDAEGQIELVRMTAYRKGFGNMIAEGYRNFAKLVDREALAYSYDV
KGLNRGWYEVDFMNGIFTLAHATSTRGADHLRGRSWAYWENDVNMDPEAVRGMLEAGLPD
YRVDPVGAVIAGERACTLADSLGRCKGSINMWFQAVPLVWKYPIFRGTAMLLTAFTGMEF
SEKDVVEALDRIYLTEMAINVKQGIRKKHYNVKFPPELAKTEKFRRQEKRHWEMVDEYLE
RRGCDVETARPKGETLERLGIGYVADEIEGKEFPEWDGPALWPLESYPGGE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccaccactggaactgaagaaagctatgccctgtttatagacctcgacagggaa
aaagccgtcaggaaaagactggcgccttctgaagttaaagcctacctcggcggcaggggc
ttcaactcaaggaagctctttgagatggtcaatggaaagatagaccctctcggcccggag
aacgttctcgccctcggaaacggcaccttcgccggcactgtccttccaatgaccagcagg
ctccacgtgagcacaatatcccctctctcggggatactcggtgacgggaacgccggcggg
gagttcgcggcgatgatgcggtatgcgggctacgaccagattgtcgtgctcggaagggcg
gacaaaccgaagtacgtctggatcgaagatgaaaccgtcgagttcagggacgcggaagga
ctgtgggggatgaagacgggggagctggttgacgtcctccgtgatgagcacggggacgat
gtaagtgtggccggtataggaccggctggagagaacctcgtcaggttcgccaccaccatg
gtggacaagtaccacgcgggggcgaggggaagcggggccgtctggggttctaagaacctc
aaggcgatagccatcagggggacgaagggcgttgaacccgccgacccggagaccttctac
gggcttgccaaggaggatctggagtacttcaagaggagcgagttcgtgaggaagatttac
tccgtcataggtacccactatggtcttctaagctggcacccgggctggaggtacttctcg
aaatatctcggccctgacgagcttccgaagggccttagacccgaggatttagcagcttac
gaagtcggcagaactcagtgctactcctgccccctagcctgcaaggacgtctactacctt
ccgaaaactggagaatacggcacgtcgagcgagttcgagtccatctacgccctcggctcg
aacaactgcatcactgacaccgaggccgtcctccagatggagcacatggcggacgagtac
gggatggacgtgataaccctcggcgacacgatagccctcgcgaggcttttgcacgagagg
ggaatcctgagcgacgaagttctcgacggcgtttccctcgaatggggagacgctgagggg
cagatcgagctggttaggatgacagcctacaggaagggctttgggaatatgatcgcagag
ggctaccgcaacttcgcgaagctcgtcgacagggaggctctggcatacagctacgacgtg
aagggtctcaacaggggctggtacgaggtcgatttcatgaacggaatcttcaccctcgcc
cacgccacctcgactaggggagcagaccacctcaggggccgctcctgggcctactgggag
aacgatgtcaacatggacccggaagcggtaaggggaatgcttgaggcagggcttcccgat
taccgcgtcgatcccgttggggcggtcatagcgggggagagggcctgcaccctagcggat
tccctcggaaggtgtaagggttcgataaacatgtggttccaggcagttccgctcgtttgg
aagtacccaatcttcagggggactgcgatgctcctcacggccttcacgggaatggagttc
agtgagaaggacgttgttgaggcccttgacaggatatacctgacggagatggccataaac
gtgaagcagggcatcaggaagaagcactacaacgtgaagtttccgcccgagctggcgaag
accgagaagttcaggaggcaggaaaagcggcactgggagatggtggacgagtacctcgag
aggaggggctgcgacgtggagacggcccgtccaaagggggaaacgctggagaggctcggc
attggctacgtggcggacgagatagagggaaaggagttccctgagtgggacgggccagcc
ctctggccgctggagagctatcctgggggtgagtga

DBGET integrated database retrieval system