KEGG   Thalassiosira pseudonana: THAPSDRAFT_22345Help
Entry
THAPSDRAFT_22345  CDS       T01078                                 

Gene name
PYK2
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:tps01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tps01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tps00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tps00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tps00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 536 aa AA seqDB search
MISNTSDVPLLAGGYINLDTVKATNNIGSRRTKIICTLGPACWDVSQLEELIESGMNVAR
FNFSHGDHDGHKACLDRLRQAAKNMNQNVAVLLDTKGPEIRTGFFADGAKSINLVKGEEL
ILTSDYAYKGDSKKLACSYEKLASSVNPGQSILVADGSLVLTVVSCDETTGEVVTRVENN
AKIGERKNMNLPGVVVDLPTLTEKDVDDIVNWGIKHDVDYIAASFVRKASDVLFIRKILA
ENGGSGIKIISKIENQEGLQNYLEILQATDGIMVARGDLGMEIPPEKVFLAQKYMIREAN
IAGKPVITATQMLESMITNPRPTRAECSDVANACYDGTDAVMLSGETANGCYYRQAVEIM
ARTCAEAETSVNWNELYQSVRNSVRKRYQLSSSESLASSAVKTAVDVGAKVIVVYSESGA
TARHIAKFRPGMPVAVLTPSEQVARQSFGLLKGSYAFVVDTLEDTHKLDKEVMRECRVAG
IAQAGDPVVIVCGSTFGTGATNQIKVEFVQSDDGDADDGKAHLDNNNAEYNGCTIC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaacacatccgacgtccctcttcttgcggggggatacatcaatctcgacacc
gttaaagcaaccaacaacatcggctcccgtcgtactaaaatcatctgcaccctcggccca
gcctgttgggatgtctctcagctcgaggaactcatcgagagtggtatgaatgtggcacgt
ttcaacttttctcacggtgatcatgatgggcataaggcatgtttggataggctacgtcag
gctgccaagaatatgaaccagaatgtggcagtgttgttggataccaaaggacctgagatt
aggactggcttctttgccgatggtgccaagtctattaatcttgtcaagggagaggagttg
atccttacgtctgattatgcatacaagggtgatagtaagaagcttgcttgctcttatgaa
aagcttgcgtccagtgtcaaccctgggcagtccattttggtggccgatggatctctcgtt
cttacggttgtttcgtgtgatgagactactggagaggttgttacccgtgttgaaaacaat
gcaaagattggtgagcgtaagaacatgaaccttcctggagttgttgtggatcttcccact
ttgacggagaaggatgtcgatgatattgtcaactggggtatcaagcacgacgtcgactac
attgccgcctctttcgtccgcaaggcatccgatgtgttgttcattcgcaagatccttgct
gagaatggtggatctggtatcaaaatcatcagtaagattgagaaccaagaaggacttcag
aactatcttgagatccttcaggctacggatggcatcatggttgctcgtggagatttgggt
atggagattcctcctgagaaagtattcttggctcagaaatacatgattcgtgaggccaac
attgccggaaagccagtaattactgccacccaaatgttggagagcatgattaccaaccct
cggcctactcgtgctgagtgttcggatgttgccaatgcttgttatgatggcactgatgcc
gttatgctttcgggagagactgccaatggatgttattaccgtcaggctgtggagatcatg
gctcgtacgtgtgccgaggcagagacttcagtcaactggaatgagttatatcagtcggtc
cgtaactccgtgaggaagagataccagctttcttcttccgaatctcttgcatcgtctgct
gtcaagacagctgtcgatgttggagccaaggtgattgttgtgtattccgaatctggagcc
accgctcgtcacatcgccaaattccgacccggtatgccagtagctgtcctcactcccagc
gaacaggttgcccgtcagtcctttggtttgttaaagggatcatatgccttcgttgttgac
actctcgaggatacccacaagcttgataaggaggtcatgagggaatgccgagttgctggt
attgctcaggctggggatccagttgtgattgtttgcggaagtacctttggaactggagct
accaatcagatcaaggttgagtttgtgcagagtgatgatggtgatgcggacgatggtaag
gctcatttggataacaacaatgccgagtacaatgggtgcacaatctgttaa

DBGET integrated database retrieval system