KEGG   Trueperella pyogenes TP8: X956_03635Help
Entry
X956_03635        CDS       T03579                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    X956_03635
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    X956_03635
Enzymes [BR:tpyo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     X956_03635
Bacterial toxins [BR:tpyo02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   X956_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(770230..773007)
Genome map
AA seq 925 aa AA seqDB search
MVPAVAGAAPSTAEPPASGTATTAAPTTNSPVTASSFKILNPKAEGENFEEGEEIKFQVT
LKNDTDVRRAFAFQSSNLNNYQKCKWWKVEPDETKEDCNFLTIKVTADDVATGSFTPRVT
WIMRKSTGHDSPVEKTGEAVGNPVPVTTKLAKLSPITVTSEEGKASYSAGDQFGYDYTVT
SLSKDKISVEGEGCPAKELDPEWSMKCSAKYAVTEEDLERGEAELTAKVKVSDGKRNVTL
TETKSVKTSRVWPQAKAFKTPNADPNLAAHLTPMQVIENNTSKYNIRIPAIAVASNGDIL
ASYDLRPLDGAWKGGDSPNENSIVQRRSKDGGKTWGPMTYIAKGKVAGDGERFGWSDPSY
VVDHTTGEIFNFHVGSLDAGLPNNPSYHLVNGKVDETYRRTMNFAVSSSKDNGYTWSSRL
ITNDVLGERAKDVTGCFATSGAGIQKMHEPFKGRLLQQAACKFKTGGFRAITIFSDDHGK
TWQSGQFASANAGAPAGQRWNFDENKIAELSDGRLILNSRVSEGYGVYKRIVATSSDGGV
NWTDIHIDNNLPDSRNNAQIIRAFPSANNGTLRAKVLLFSNTEKPNNRVDGKVKMSYDDG
KSWPIAKQIRNGGTGYTTMAVQPDGSIGLLMEPDTWNKVGYVNFTLKTLAENLPFEVALE
KISDVKTTDGTPIAPIKVTSTGNDPALADTYSAEGLPAGLKINAETGQIEGTPAVGNTDV
KNFDVKVTLTEAEDGTGIPRTSSQTFKVTLAPNPTPAPAPEPGVVSVVPNAPVFPDASDP
VTCTVKPFVTLQPTKGVSYSVTVDGKELDWVEGNPSRFEYDYGKTVVVKAKAVEGFVLAK
GAKTQWSWTAPTLDELGCTTTPKPEPKPTPDPKPTPDPKSTIIAQAKAPKSSLVHTGATV
VGLSVAAAVLLLAGGAIAIIRRRQS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
gtggttccggcggttgcgggtgcagccccgagcacagcggaaccgcctgcttcgggaaca
gccacaacagcggctcccactacgaattcgcccgttacagcttcgagcttcaagattctc
aaccccaaagccgagggcgaaaattttgaagagggcgaggagatcaaattccaggtcacc
ctcaagaacgacactgatgttcggcgcgcatttgccttccagagctccaacctcaacaat
tatcaaaaatgtaaatggtggaaagtcgaaccggatgagactaaggaagattgcaatttc
ctcaccataaaagtcacagctgatgatgtagccacagggtccttcacgcctcgagtcaca
tggatcatgcgcaaatcaacagggcatgattctccggttgaaaagacaggtgaagccgtg
ggcaacccggttccagtgaccaccaagctcgcaaagctttcacctatcaccgtgaccagc
gaagaaggtaaggcatcctacagtgccggggatcagtttggttacgattacaccgtcacc
tcgctatcaaaagataagatttccgtcgagggtgaaggatgtccggccaaggagctcgat
ccggaatggagcatgaagtgctcggcaaagtacgcggtcacggaggaagacctggagcga
ggcgaagccgaattaactgccaaggttaaagtcagtgacgggaagcgaaacgtcactctc
acagaaacaaagtcagtcaaaacttcccgggtatggccgcaggcaaaggcttttaagacg
ccgaacgccgatccgaacctggcggcgcacctaactccgatgcaggtgattgagaataat
acttccaagtacaatattcgcattccagccatcgcggtggcctccaatggtgacatcctg
gcctcctacgacctgcgtccgctcgacggcgcgtggaagggcggcgattctccaaatgag
aattccattgtccagcgtcgatctaaggacggtggcaagacgtggggcccaatgacttac
atcgcgaaaggtaaagttgcgggcgatggcgagcgcttcggctggtcggacccgtcctac
gtggtcgaccatacaacaggagagatcttcaacttccacgtcggttctcttgatgcaggt
ttgcctaataatccttcctaccatctcgtaaacgggaaggtagatgagacttaccggcgc
acgatgaacttcgcagtgtcctcatcgaaggacaacggttatacctggtcctcgcggctg
attacgaatgatgtgctcggagaacgggctaaggacgtgaccggttgctttgcgacatcg
ggcgctggcatccagaagatgcacgagccgttcaagggacgtctcctccagcaggcagca
tgtaagttcaaaactggtggcttccgcgccatcactatcttctctgacgaccatggcaag
acatggcagagcggacaattcgcctccgcaaatgcgggtgctcctgcaggccaacgttgg
aacttcgatgagaacaagatcgcagagctatccgacgggcgccttatattgaactcccgc
gtttccgaaggctatggcgtatacaagcgtattgtggcaacgtcgagtgatggcggcgtg
aactggacggacatccatatcgataacaatcttcccgattctcgcaacaacgctcagatc
attcgtgctttcccgtcggcaaacaacggcacgttgcgcgcgaaggtgctcctcttctct
aacacggagaaaccaaacaatcgcgtcgatggcaaggtcaagatgagctacgatgacggc
aagtcttggcctatcgccaagcagattcgcaacggcggaaccggttacacgacgatggcg
gttcagcccgacggttcgatcggtctgctcatggaaccagatacgtggaacaaggtcggc
tacgtgaacttcacgctcaagacgctcgctgagaatctgcctttcgaagttgctctcgaa
aagattagcgatgtcaagacaaccgatgggacgccgatagcccccatcaaggtgacctcc
accggcaatgatccagccctcgcggacacctactcagctgaaggactcccggctgggttg
aagatcaatgccgaaactggccagattgaaggcacccctgcggttggcaacacggacgtg
aagaactttgacgtcaaggtgaccttgaccgaggctgaggacggcacgggtatcccgcgc
acgtcgtcgcagaccttcaaggtcacccttgccccgaacccgacgccggcaccggctccc
gagcctggtgtggtgagcgtggttccgaatgctccggtcttcccggatgcgtctgatccg
gttacatgcacggttaagccgtttgtcacgctccagccgacaaagggtgtctcgtactcg
gtaacagttgatggcaaggagcttgactgggttgagggcaatccgtcgaggttcgaatac
gactatggcaagaccgttgtggtcaaggccaaggctgtcgagggcttcgtgttggctaag
ggtgcaaagacgcagtggtcgtggactgccccgacactcgacgagctcgggtgcacaacc
acacctaagcctgagcccaagcccaccccggatcccaagcccacgccggatcccaagtcg
acaataatcgcccaggctaaggcgccgaagtctagcctggtccacaccggtgctacggtc
gttggcctgtcggtcgctgccgcggttctgctcctcgcaggtggtgctatcgcgattatt
cgccgtcgccagagctaa

DBGET integrated database retrieval system