KEGG   Trichoderma reesei: TRIREDRAFT_105631Help
Entry
TRIREDRAFT_105631 CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
Organism
tre  Trichoderma reesei
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 18481078
NCBI-ProteinID: XP_006963944
JGI: Trire2_105631
UniProt: G0RFF6
LinkDB All DBs
Position
Unknown
AA seq 402 aa AA seqDB search
MPGLIPLRMSTLIPASKYTYSISEGKSNQTYNDRSWKSTPSRPRENEEDRRTARQRTTPA
PIVASKPTPSTPEQWKRALGDVKRDFNNRKYRQCSLRCHELLGDIKDSNKPETACLIYIR
FYAASALEMQVRSLPPNSPHRTKLLYQARDHYRVAAHLIREDEATKRRPSSRSLPSLTSH
HTPYGSDASISTVSTRISSSSLSISSLDSCLKSRNSRPKPKKRVAFCDVPSYEPSHEPAY
ESSYEPIVRPDSPTLGFDDDWGVRQPTPEPLALYSQPLRSSSGRPQFPLPSPTNSEFSVV
QDDDNYYDTPAAADSFLHARSVHHYCTVLSDLQRQIASHLEWLERDIAAAENPKPTPALS
EEMRALELQTRIERLRANGWKRQRFDFRKYEALRENALADIN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccgggacttatccccctccgtatgagcacgctcattccagcttccaaatatacatac
tctatctcagaagggaaatccaaccagacatacaatgatagatcctggaaatcgacgccg
tccagaccgcgagaaaacgaggaggatcggcgcacagcgcgacaacggacaactcctgcg
ccaatcgtcgcctctaaaccaaccccttcaacgcctgagcagtggaagagagcgctgggc
gatgtgaagagagacttcaacaaccgaaagtatcgccaatgctcattgcgatgccatgaa
ctgctcggcgacatcaaggactcaaacaagccggagacagcatgcctcatctacatccgc
ttttatgcggcttctgcccttgagatgcaggtccgctcactcccacccaactctccgcac
cgcacaaagctgctctaccaagcccgcgatcactatcgcgtcgccgcccacctcatcaga
gaagatgaggctactaagcgacgtccctcctctcgctctctcccctcgttgactagccac
cacactccttatggctcagacgcctcaatctccacggtctctaccagaatttcctcttcc
tcgctatcgatcagctccctcgatagctgtttgaaaagccgcaacagtcgacctaagccg
aagaagcgcgtcgctttctgtgacgtgccgtcttatgagccttctcacgagccagcctac
gagtctagctatgaacccatcgtgcgcccagactctcctaccctcggattcgacgacgac
tggggcgttcgccagccgactccggaacctctggccctctactctcagcctctccggtcc
agctccgggaggccgcagttcccactcccttcccccacaaactccgagttcagcgtcgtc
caagatgacgataactattacgatactcccgcagctgcggacagcttcctccatgcccgc
tccgtccaccactactgcaccgtgctttcggacctgcagcggcagatcgcctctcacctg
gaatggttggagcgcgacattgccgccgcagagaaccccaagcccacgcctgccctgagc
gaagaaatgcgcgctcttgagctgcagacgcggatcgagcggctgagggccaacggctgg
aagcgacagcggttcgacttccgcaagtacgaagctcttcgagagaacgccttggcagat
atcaactga

DBGET integrated database retrieval system