KEGG   Trichoderma reesei: TRIREDRAFT_65533Help
Entry
TRIREDRAFT_65533  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tre  Trichoderma reesei
Brite
Enzymes [BR:tre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRIREDRAFT_65533
Chromosome [BR:tre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     TRIREDRAFT_65533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 18487319
NCBI-ProteinID: XP_006967251
JGI: Trire2_65533
UniProt: G0RPN6
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MASPPNAEPPRRAAAAATSSSTSSSSGSGSSSRDEGAGLSQSLSQLSLGQRGPRSPGLSP
SPSTPRTPLNAPSHASPSTSPSARAPSLSPSGRDSRAATPTLVRKASMNSLHSASGLGSS
RPLSRRSSLGVMSPGLRASFGNPEPEWRPPVTPSSVANGHFKDELEAHHGPVSTLYTETV
VVLNDAVYGHRFSRPRTPKSALNTIVERPERIKASVLGVSAAYVRLGERHSDGALPILPK
SNVHMLPSIPFRIHKTDRRLSLLSPAVTNVHGTKWMEEFKMMCESAESILARGGKELQRP
SITRGPDHAAPETLHEGDLYLCNESLEAIEGALGAVCEGVDAVFSAGPRRAFVAVRPPGH
HCSANLPSGFCWVNNVHVGIMHGILNHGLTHAAIIDFDLHHGDGSQAIAWAHNSRSMAAT
KNHAAWKKTSIGYFSLHDINSYPCENGDDDKIKNASICIENAHGQNIWNAHLQPWKTTEE
FWDLYETRYSILLDKARSYLRGQAERLRDAGASPRAVIFLSAGFDASEWESAGMQRHKVN
VPTEFYARLTQDVVRLAAEEGLCVDGRIVSVLEGGYSNRALTSGIISHLSGLVGKQNVPH
RSRLSFPQGDDYNEEDDHVPHSPASINPYDPSWWSAREMDKLEAAVALPDITPKKPRMAT
PPTYCTPTHASTARAVDPLRMRRSMSTLVNRSTVSSRSPSPSPPEIPWTVAASELSKLLI
PRDRQTDSCTFEELNADAARVRRDRQSAGTPELERSASRMSLRDRKPRAIDPIQEEHQSR
QTRDRSKTVATIAAEKATARGQTPQPIIGLPPKKSNRRLTASSAVPAQRSVSRAAATHEE
LPLRPSTSAGPIAGRPLSVAGHQAQSPGSTGRITVRRSRPTSSSGEPAPRSPMVEAGKEA
PAQGTTAPAVSRLDATIDDMDKITKGIKKIKINLITQSQKEAREKARLEAEAAAAAATAS
GELRPSLSTPNFEHVTPRTLSPEARQAVPNVSSPRSAKASDEAHEFLQYQPEGPPPVPMT
SQEPLKWLPPSLPAGPPTVQPGLVKKSSTLFQYGGSGTIPFAKQPANRSPPAQKAQRQPS
GSVRGTLSPKK
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctccgcccaatgctgagccgccacggcgtgctgcagcagcagcaacctccagc
agcaccagctccagctccggctccggctccagctccagggacgagggcgcaggcctatcg
cagtcactcagccagctgtcactcggccagcgtggtccgcgatctcccggcctctcgcca
tcgccctcgacgcctcggacgcccttaaatgccccgagccatgcctctccctccacctct
ccctctgcccgcgctccctccctcagtccctcaggcagagactcgcgagctgcaaccccc
accctcgtccgcaaagcctcgatgaactccctgcactcggccagtggcctcggctcttcg
cggcctctatccaggcgctccagcctgggcgtcatgtcaccgggcttgagggcgtccttt
ggcaatcccgagcccgagtggcggcccccggtgacgcccagctccgtggcgaacggccac
ttcaaggacgagctcgaggcccatcacggccccgtgtccacgctctacaccgagacggtt
gtcgtcctgaacgatgccgtctacggccaccgcttctcgcgcccacgcacccccaagagc
gccctcaacaccatcgtcgagcgccctgagcggatcaaggccagtgttcttggtgtgtct
gcggcctatgttcgtctcggcgagcgtcacagcgacggcgcgctgcccatcttgcccaag
agcaatgtccacatgctgcccagcatcccctttcgcatccacaagacggaccggaggctg
tcactactgtcacctgccgtcaccaatgtacatggcaccaaatggatggaagagttcaag
atgatgtgcgagtcggccgagtccatcttggctcgtggaggaaaggagctgcagaggccg
tccataacccggggccccgaccatgctgcccctgaaacgctgcacgagggcgacctctac
ctttgcaacgagtcgctagaagccatcgagggtgctttgggtgcagtgtgcgagggcgtg
gatgccgtcttctctgccgggccgcggcgtgcctttgttgccgttcggcctccgggacac
cattgctctgccaacctgccgtcaggcttctgctgggtcaacaatgtccacgtgggaatc
atgcatggaatcctcaaccatggcctgacgcatgccgccatcatcgactttgacttgcat
cacggagatggctcccaagccatcgcctgggcgcacaactctcgatccatggccgcgacc
aagaaccatgccgcctggaagaagacgtccatcggctactttagcctgcacgacatcaac
tcttatccctgtgagaatggcgacgatgacaagatcaagaatgcaagcatctgcatagag
aatgcgcatggccaaaacatctggaacgctcacctgcagccgtggaagacaaccgaggag
ttttgggatctctacgagacgagatactcgatacttctcgacaaggcacgtagctacctc
agaggccaagcggaaaggctacgagacgcaggcgccagcccgcgagccgtcatcttcctg
tctgctggattcgatgcgagcgaatgggagagcgcgggaatgcagcgccacaaggtcaac
gtgcccaccgagttctatgctcgcctcacccaagacgtggtccgactggccgcagaggag
ggcctctgcgtcgacggccgcatcgtcagcgtcctggagggcggctatagcaaccgagca
ctgacttccggcatcattagccatctcagtggcctcgtagggaagcagaacgttcctcat
cgaagccgcctttctttcccgcagggtgatgactacaacgaggaagatgaccacgtcccg
cactcccccgcttccatcaacccgtacgatccctcgtggtggtcggctcgtgagatggac
aagttggaggccgctgtagcgctccctgatattacgccgaagaagccgcgtatggctacg
cccccgacctactgtacgccgacgcatgcttctacggccagggctgtagaccctctcagg
atgcggcgaagcatgtcgactctggtcaacaggtcgacagtctccagccgctctccatct
ccgtcgccccctgagatcccatggacggttgctgcaagcgagctgtcgaagctcctcatc
ccacgagatcgccaaaccgacagctgcacttttgaggaactgaacgccgatgccgcacgg
gtacgacgcgacagacagtccgctggcactccggaactcgagcgatcagcatcgaggatg
tcgcttcgcgaccgcaagcctcgggccattgaccccatccaggaggagcaccagtctcgg
cagacgagggaccggagcaagactgtggccaccattgcagcagaaaaggcgaccgctcgc
ggacagacgccgcaacccattatcggtctgcctccgaagaagtccaaccgacggcttacc
gcgtcgtcggctgttcccgcgcaacgcagcgtctctcgtgccgcagcaactcacgaggaa
ctgccccttcggccttcaacctccgcggggcctatcgccgggaggcccctctcagttgca
gggcaccaggcccagagccccggctctactggcagaattaccgtcaggagatcgcggccc
acctcatcgagcggcgaacccgcccctaggtcgcccatggtcgaagccggaaaagaagct
cctgcgcaaggaactacggcacctgcagtatcaaggctggacgctactattgacgacatg
gataagatcaccaaaggaatcaaaaagatcaagatcaacttaatcacccagtcgcaaaag
gaggcacgggagaaggcccgcctcgaggctgaggccgcagctgcagccgctaccgcgtct
ggtgagctgcgtccctccctgtcaacgcccaactttgagcacgttacaccaaggactctt
tctcccgaagcgagacaggccgttccaaacgtgagctcgcctcgctcggccaaggcgagc
gatgaggctcatgagtttctccagtaccagcctgaagggccacctccggtgcccatgacg
tcccaggagccgctcaagtggcttcccccgtcgcttcctgctggccctccaacggtacag
cccggcctcgtgaagaagagcagcacgctcttccagtatggcggcagcggcaccattccc
tttgccaagcagccggctaaccgaagcccgcctgctcagaaggcacagagacagccaagc
ggttctgtcaggggcaccctttcgcccaagaaatag

DBGET integrated database retrieval system