KEGG   Takifugu rubripes (torafugu): 101064049Help
Entry
101064049         CDS       T02386                                 

Gene name
tgm2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101064049 (tgm2)
Cell adhesion molecules and their ligands [BR:tru04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101064049 (tgm2)
   VLA-5
     101064049 (tgm2)
   VLA-9
     101064049 (tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 678 aa AA seqDB search
MSEALDIDRLDLECEYNNVEHRTDLNGIDRLIVRRGQQFSIRLYLRSGSYQPGVSALDCV
AETGPQPSEQYGTRAAFGLTADVNTSCWSAAITSPPGDTLALSICSAPDAPIGRYSLSLG
QSARIEFVLLFNPWCPGDAVYMDNERSLEEYVLSQDGIIFRGTYKYPIPLPWNFGQFESG
ILDICLRTLDMNPKYLRNPGKDCSGRRNPIYVTRVLSAMINCNDDKGVLLGKWTDGYEGG
ISPMFWRGSVEILRNWDTQACQPVRYGQCWVFAAVACTVSRALGIPCRVITNFASAHDTN
NNLVIERYINENGDLVQSREMIWNYHCWVESWMTRPDLKSGFNGWQASDPTPQEKSDGVY
CCGPVPVKAIKEGELLLKYDAPFVFAEVNADVNTVMQKKDGSTSRVNTTTFVGQKISTKS
VGSDVREDITNLYKYPEGSDEEREVFEKANHRNKLLQQQQNQGLHITIKVGTDARKGCDF
DVFAVVTNNTHSEKKCRLVFGSCAVSYSGYVGGNCGFKDLLNVELAPGGERKVPLRLNYS
KYGGQLTDDSLIRLAALLFDYSTREPVLAVRNIVLTDPEIKVRILGEPKQNRRLAAEITL
QNPLPEPLQDCCFSIEGANLTGGHVISQRLDSCVAPGEDAKVKIYFTPTHSGMRKLVVDF
DSNKLCHIKGFRNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagctctggatattgatcgattggacctggagtgcgagtacaacaacgtggaa
caccgcacggatctcaacggcatagaccgcctgattgtgaggagaggtcaacagttctcc
atcagactgtaccttcgttccggctcctaccagccgggggtcagcgctctggactgcgtt
gcagaaacaggcccccaaccctcggagcagtacggcaccagggctgcctttggcctgact
gctgatgtgaacacttcctgctggagcgccgccatcaccagcccccccggggacacgttg
gccctgtccatctgctctgcccccgatgcgcctataggccgatacagcctgagcctgggg
cagtcggcgaggattgagttcgtcctgctctttaacccctggtgtccaggagatgcggtt
tacatggacaatgagcggagtttggaggaatacgtgttatctcaggatgggatcatattc
cgaggaacctacaaataccccatacctctgccctggaactttggccagtttgaaagtgga
atcctggacatctgtttgaggacactggacatgaatcctaagtacctgagaaaccctggc
aaagactgctcaggaaggagaaatcccatctatgtgaccagagtgcttagcgccatgatt
aactgtaatgacgataaaggagtgttgttggggaagtggacggacggctacgagggaggc
atcagtcccatgttctggaggggcagcgtggaaatcctgcgcaactgggacacacaagca
tgtcagcccgttcgttacgggcagtgctgggtgtttgctgcggtggcctgcacagtttcc
agagctctcggcattccctgcagagtcatcaccaactttgcatcggcccacgacacaaac
aacaacctggtgatcgaacgctacatcaacgaaaacggggacctggttcagtccagagaa
atgatctggaattatcactgctgggtggagagctggatgaccagacctgatctgaaatcg
gggtttaatggctggcaggccagtgacccaacgcctcaggaaaagagcgacggtgtgtac
tgctgcggtcccgtccctgtgaaggccatcaaggagggggagctcctccttaaatacgat
gccccgtttgtcttcgccgaggtcaacgccgacgtgaacaccgtgatgcagaagaaggac
ggcagcacatccagggtcaacaccaccacgttcgtgggccagaagatcagcacaaagagc
gtgggcagcgacgtcagggaggacatcactaatctctacaagtaccccgaaggctccgac
gaagagcgcgaggttttcgagaaggccaaccaccggaacaagctgctccagcagcagcaa
aaccagggcctccacatcaccatcaaggtgggaacagacgcgaggaagggctgcgatttc
gacgtgttcgccgtggtcaccaacaacacgcacagcgagaagaagtgccgcctggtgttt
gggtcttgcgcggtgtcgtacagcggctacgtgggaggcaactgcggattcaaagacctg
ctcaatgtggagctggcgcctggtggagagaggaaagttcctttaaggctgaactactcc
aagtacggtggccagctcaccgacgacagcttaatccgcctggcggctctgttgttcgac
tacagcactagagaaccggtgctggcagtcagaaatatcgtcctgacggaccctgaaatc
aaagtcagaatcctgggtgaacccaagcagaaccggaggctggccgcagagatcaccctg
cagaaccccctgccagagcccctgcaggactgttgcttcagcatcgagggggccaacctc
accgggggacacgtcatctcacagaggctggactcctgtgtggctcctggggaagacgcc
aaagtgaaaatctacttcactccgacccactccgggatgaggaagttggtggtcgacttt
gacagcaacaagttgtgtcacattaaaggcttccgaaatgtcattattgggaaatga

DBGET integrated database retrieval system