KEGG   Takifugu rubripes (torafugu): 101064304Help
Entry
101064304         CDS       T02386                                 

Gene name
nsd2, whsc1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101064304 (nsd2)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101064304 (nsd2)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101064304 (nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 1366 aa AA seqDB search
MDSKGSSLPSMPEPANPVSMKQLPEPLSVRKNGGDMSSDHSMLMDKAAAHLAATLQDSVL
QKMASHSHGNHSHERLKDLTSLVLNGDQDTLPKLSTPEQPLLKSAEVPTTNGTHQHNCSS
HSEPELKVTVPQVVTQQPPFQPSSVNGTSLATTTESTVRTPEKREDAKKRRGRPHKEKPQ
ASLRPAPVPAEPLHSVNAKDASGAVGEPDLKPEAKHKESPLLITLSVGDLVWTKVSGYPW
WPCMVTTDPNFNSHFKQKQKASSSKTGVLYHVQYFGDAPERGYVFEKNTVPFTGEDQYHD
LCQCKKPPASRSAHKKVRPLRPLLSDTVQMAPSVPRKFRAQWNMGIIQAKEALNMPVEER
MANFLFLYDDKGPRLNPHIMEKLKPEASLDRDPEFRAQPDLPSQPADPLGDLTAQFSNST
SAEMKGAVSSKEMLHPPAETQDPLSSAAEAQADTSQKIKGSEQTQSAKKTVRRKKSAAEN
SSDPVKKKRKTAQSRPTEDAPESSSVTGQGVKKRQKKNIAAKQRTDSAAEQDPKTSPERP
LSGEAAVKGPGLKKRRKINKEAEKEAGSSEESSKKRRRNKPEKDATGTQKQQKKAAELLT
DDQNAEKPKRKRKRRQDGENQAAASKAKKRRLSPCPDPEVSGGEERPDSPIDSLDGTKKG
ERKKEFVCQSCEKAGEDLVPCEGQCCGMFHLQCLGMMELEDKLLCQECSTGVHSCFHCKK
SEGSVRRCHVPHCGKFYHEACIRLNPLTVFDNKGFRCPLHTCLGCCCSSRTKHKPSKGRL
MRCLRCPVAYHAGDLCVAAGSEMVTSTAIICTNHFNAKKAYRHHSHVNVSWCFVCSKGGQ
LLCCESCPAAFHPDCLNIAMPDGSWFCNDCRAGKKPKYRDIIWVKLGKYRWWPAEIHHPR
NIPTNIQHLRHEIGEFPVFFFGSRDYFWTHQGRVFPYMEGDRGSKYQRTGIGKVFKHALL
EAEARFKEIKMKREKKEAQQYSRKPPPYKFIKVNKPVGKVQVYAADVSEIPKCNCKPSDE
RPCGFESECLNRMLQYECHPQVCPSGERCGNQDFTQRLYPDTKIIKTPGKGWGLITLRDI
KKGEFVNEYIGELIDEEECRARIKYAQENNVTNFYMLTIDKDRIIDAGPKGNYSRFMNHS
CQPNCETQKWTVNGDTRVGLFAICDVPAGTELTFNYNLDCLGNEKTACCCGAPNCSGFLG
DRPKNSNGHAAEPKAKRGKRKYKKRKSEGRKKSEDECFRCGDGGQLVLCDKKTCTKAYHL
SCLNLTKRPFGRWDCPWHHCDVCGKNSEAFCQLCPNSFCKCHQEGALRPSPVTGQLCCQE
HEELDVPTSPGRDDGSETNTTSPAGTDGRPPKGSNARTKSSKRKAE
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaagggagctccctgccttcgatgcctgaaccagccaaccccgtcagcatg
aagcagctaccagagcccctcagcgtgcgaaagaatggaggagacatgagcagcgaccat
tctatgctaatggacaaagccgccgctcatctcgctgccacgctacaggacagcgtcctc
cagaagatggccagccacagtcacggtaaccacagccacgagaggctcaaagacctcacc
tcccttgtgctgaacggggaccaggacacgcttcctaaactctccactccagagcagccg
ttgctcaagagcgctgaagttcccaccacaaacgggacccaccagcacaactgcagctcc
cacagtgaacctgagctgaaggtcactgttcctcaggtggtcacacagcagccccccttc
caaccaagctctgttaatgggaccagtttggccacgaccacggaaagtactgtacgtaca
ccggagaagagggaggatgcgaagaaaaggagggggaggccacacaaagagaagccgcag
gccagcctcaggcccgctcccgtcccggcagagccgctccacagcgtaaatgctaaagat
gcaagtggagccgtcggcgagcctgatctcaagccggaggccaaacacaaagagtctcct
ctgctgatcacactctccgttggggatctggtgtggacaaaggtgtcggggtacccctgg
tggccttgcatggtgaccacagaccccaacttcaacagtcacttcaaacagaaacagaaa
gcctccagcagcaagacgggcgtcctctaccatgtgcagtattttggagatgcacctgag
agaggctacgtctttgagaagaacacggtgcccttcacaggagaggatcagtaccacgac
ctgtgtcagtgcaagaagccgccagcatcacgcagcgcccacaagaaggtgcgtcccctc
cgtcctctgctgtcggacacagtccagatggctccctcggtcccccgtaagttcagggct
cagtggaatatgggaattattcaagccaaagaggccctcaacatgccggtggaggagcgc
atggcaaacttcctgttcctctacgacgacaaagggcctcgcctgaacccccacatcatg
gagaagctgaaaccagaagccagcttggatcgtgaccccgagttcagggcgcagccagat
ctcccttcacagccagcagatcctctgggagatctcacggctcagttctccaacagcact
tcagccgagatgaagggcgccgtttcttccaaagaaatgcttcatccccccgcagagacc
caggatcctcttagttctgcagcggaagcacaagccgacacgtcccagaaaataaaaggg
tccgaacagactcagtcagccaaaaaaacagtgaggagaaaaaagtctgcagcggaaaac
agttcagatcctgtgaagaaaaagcgtaaaacggcgcagagtcgtccaacagaagacgct
ccagagtcctcctcagttacaggtcaaggtgtcaagaaaaggcaaaagaaaaatattgcc
gctaagcagaggacagattctgcagctgagcaagatcccaaaacgtcccctgagaggcca
ctgagtggcgaggcagcagtcaaaggtccgggcctcaaaaagaggcgcaaaatcaataaa
gaggcagaaaaagaggccggctcctcggaggaaagcagcaaaaagaggagaagaaataaa
ccagagaaagacgcgacaggaacccagaagcaacagaaaaaagcagccgaactcctcact
gatgatcaaaacgcagagaaaccaaagcgcaagaggaaaaggagacaggatggagagaac
caggctgcagcctccaaggccaagaagaggagactgtcgccgtgtcccgatcctgaggtc
tctgggggcgaagagcgtccagactcgcccatcgacagcctggacggcaccaagaaggga
gaacgtaagaaagagtttgtctgccagtcctgtgagaaggccggtgaagacctggtgccc
tgcgaaggtcagtgttgtgggatgtttcacctccagtgtctgggcatgatggagctcgag
gacaaattgctgtgtcaggagtgcagcacaggagttcactcgtgtttccactgtaagaag
tcggagggctcggtgcggcgctgccacgtcccccactgtggtaagttctaccacgaagcg
tgcatccgcctcaacccgctcacggtgtttgacaacaaggggttccgctgcccgctgcac
acctgcctgggctgctgctgcagcagccgcaccaagcacaagcccagcaaaggcaggtta
atgcgttgcctgcgctgccccgtggcgtaccacgccggcgacctgtgcgtggcggccggg
agcgagatggtcaccagcaccgccattatctgcaccaaccactttaacgccaagaaggcg
tacaggcaccacagccacgtcaacgtcagctggtgcttcgtctgctccaaaggaggacag
ctgctgtgctgcgaatcgtgtcccgcagcctttcaccccgactgcctgaacatcgccatg
cccgacgggagctggttctgcaacgactgcagagccggaaagaagcccaaatacagagac
atcatctgggtgaagttggggaaatacaggtggtggccggcagagatccaccatcccaga
aacatccccaccaacatccagcaccttcgacacgagatcggagagttccccgtcttcttc
ttcggttccagggactacttctggactcaccagggccgagtgtttccatacatggaggga
gacagaggcagcaagtaccagaggaccggcatcggcaaagtcttcaagcacgctcttctg
gaggctgaagctcgattcaaggagataaagatgaaacgagagaagaaggaagctcagcag
tacagccgaaaacctcccccctacaaattcatcaaggtcaacaaacccgtggggaaggtc
caggtgtacgccgccgacgtctccgagatccccaagtgcaactgcaaaccctcggacgag
aggccgtgcggcttcgagtcggagtgtctgaaccgcatgctgcagtacgagtgccacccg
caggtgtgtcccagcggggagcgctgcggcaaccaggacttcacccagcggctctacccc
gacaccaagatcatcaagacccccggcaaaggctgggggctgatcaccctgagggacatc
aagaagggcgagtttgtgaacgagtacatcggcgagctgatcgacgaggaggagtgcagg
gcgagaatcaagtacgcccaggagaacaacgtcaccaacttctacatgctgaccatcgat
aaggaccggatcattgacgccgggccgaaggggaactactcccgcttcatgaaccacagc
tgtcagcccaactgtgagacgcagaagtggacggtgaacggagacacgcgcgtcggcctg
ttcgccatctgtgacgtcccagcaggaaccgagctgacgttcaactataacctggactgt
ctcggcaacgagaaaacggcgtgctgctgcggcgctcccaactgcagcggtttcctgggc
gaccggccaaagaactccaacggccacgcggccgagcccaaagccaagcgagggaagagg
aagtacaaaaagaggaaaagcgaagggaggaagaagtcggaggacgagtgttttcgctgc
ggcgacggcggtcagctggtgctgtgcgacaagaagacctgcaccaaagcgtatcacctg
tcctgcctgaacctcaccaagaggccctttggacgctgggactgtccctggcaccactgc
gacgtctgcgggaaaaactcggaggccttctgccagctctgccccaactccttctgtaag
tgtcaccaggagggggcgctgcgtccctctcctgtcacagggcagttgtgctgccaggag
cacgaggagttggacgtccccaccagccccggtcgggacgacggatctgaaacgaacact
acgagcccggccggcaccgacggccgtcctcctaaaggctccaacgccagaaccaagagc
tccaagaggaaagcggagtga

DBGET integrated database retrieval system