KEGG   Terriglobus saanensis: AciPR4_2709Help
Entry
AciPR4_2709       CDS       T01408                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00010  Glycolysis / Gluconeogenesis
tsa00052  Galactose metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
Module
tsa_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciPR4_2709
   00052 Galactose metabolism
    AciPR4_2709
Enzymes [BR:tsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AciPR4_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADV83483
JGI: AciPR4_2709
UniProt: E8V1Z5
LinkDB All DBs
Position
3341729..3342841
Genome map
AA seq 370 aa AA seqDB search
MKLLWTGILMTGLTAGLGINAHAAVTKAPFGKLPDGKAVEIYTLKSATVEARVMTFGARI
VSVRTPDRAGHVADVVLGYENIEGYLADKKTYFGAIVGRYGNRIAGGKFSLDGKSYQVPT
NDHGNSLHGGTSGFDQKLWTAKEVSNGVEMTLVSPDEDMGFPGTLTTHVTYTLVGNALHI
DYVSTSDKDTVLNLTNHSYFNLNGDGASDILSHSITIDSEHFTPVDATLITTGNMDTVAG
TPMDFRQPHTMGERINSDFAQLKLGGGYDHNWILNGPNGVIKRAAFVLDATTGRTLTVTT
TEPGVQFYTGNFLDGSFKGKNGISYGKRTGFCLETQHYPDSPNHPGFPSTELKPGQIAKS
TTIFTFGVQK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagctactttggacgggaatactcatgacgggtttgacagcaggattaggtataaac
gcacatgcggcagtaaccaaagcaccttttggcaagcttcccgacggtaaagccgttgaa
atctacactctgaaaagtgccacggtcgaagcgcgagtaatgaccttcggcgctcgtatc
gtcagcgtacgcacgccagatcgcgccgggcatgtggccgacgtagtgctcggctacgaa
aatatcgaaggatatctcgcagacaagaaaacatactttggtgcgattgtgggtcgctat
ggcaaccgtatcgcaggcggcaagttttcactcgacggcaagtcctaccaggttcctaca
aacgatcatggcaactccctgcacgggggtaccagtggtttcgatcaaaagctctggacg
gccaaagaagtcagcaacggagttgagatgactttggttagtcctgacgaagatatgggc
ttccccggcacgctcacaacgcacgttacctacacgctcgtgggaaacgccctccatatc
gactacgtctcaacctcggacaaagacaccgttctgaacctcacaaaccacagctacttc
aacctgaatggagacggcgccagcgacattctgagccactccatcacgatcgactccgag
catttcactccagtggatgccacgctcatcacgaccggcaacatggataccgtagccggg
acgccgatggacttccgccaaccccacaccatgggtgagcgtatcaacagcgactttgca
caactcaaactcggtggcggctatgaccacaactggatcctgaacggacccaacggcgta
atcaagcgcgccgcctttgtgctggatgctacgaccggacgcacgctcaccgtcaccacc
accgaaccgggcgtacagttttacaccggcaacttcctcgatggttcattcaagggcaag
aacggaatcagctacggcaaacgaacaggcttctgcctggagacgcagcactatccggac
tcgcccaatcaccccggcttcccttccacagaactgaagcctggacaaatcgcaaagtcg
accacgatcttcaccttcggtgttcagaagtag

DBGET integrated database retrieval system