Terriglobus saanensis: AciPR4_3269 Help Entry AciPR4_3269       CDS       T01408                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism tsa  Terriglobus saanensis Pathway tsa02024   Quorum sensing tsa03018   RNA degradation Brite KEGG Orthology (KO) [BR:tsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AciPR4_3269  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AciPR4_3269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tsa03019]     AciPR4_3269    03036 Chromosome and associated proteins [BR:tsa03036]     AciPR4_3269 Messenger RNA biogenesis [BR:tsa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AciPR4_3269 Chromosome and associated proteins [BR:tsa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AciPR4_3269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  ADV84025 UniProt:  E8V843 LinkDB All DBs Position complement(3971534..3971821) Genome browser AA seq 95 aa AA seqDB search MDSKPAQNIQDTFLNTVRKDKSPITIYLVSGVKLTGKIRSFDKYSVLLENNAQEQLIFKH AISTVVSTRGGAHVERAHAPVSSAGVSGEAGSPAA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggattccaagccggcacagaatattcaggacactttcttgaacaccgttcgcaaagac aagtcccctatcacgatctaccttgtgagtggcgtaaagttgacgggcaagatccgttcc tttgataagtattcggttctcctggaaaacaatgcccaggagcagttgatcttcaagcat gcgatttcgacggtagtcagcacacgcggtggagcacatgtggaacgggcccatgctcct gtctcgtcggcgggtgtctccggcgaggcaggatcgccggcggcctag

DBGET integrated database retrieval system