KEGG   Thermus scotoductus: TSC_c00040Help
Entry
TSC_c00040        CDS       T01414                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
tsc  Thermus scotoductus
Pathway
tsc00010  Glycolysis / Gluconeogenesis
tsc00230  Purine metabolism
tsc00620  Pyruvate metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
tsc01230  Biosynthesis of amino acids
Module
tsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsc_M00002  Glycolysis, core module involving three-carbon compounds
tsc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tsc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c00040 (pyk)
   00620 Pyruvate metabolism
    TSC_c00040 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    TSC_c00040 (pyk)
Enzymes [BR:tsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     TSC_c00040 (pyk)
Membrane trafficking [BR:tsc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TSC_c00040 (pyk)
Exosome [BR:tsc04147]
 Exosomal proteins
  Proteins found in most exosomes
   TSC_c00040 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: ADW20657
UniProt: E8PQZ7
LinkDB All DBs
Position
4089..5513
Genome map
AA seq 474 aa AA seqDB search
MRPFKRTKIVATLGPASDSKEAIRALAEAGADVFRLNFSHGTHEEHRRRAAWVREVEKEL
GKTLAILQDLQGPKIRIGRFKEGRVELKAGQPFILTRAPVEGDETRVSITYKGLPEDVAP
GQVLLLDDGRLRLRVERIQGDEIHTVVELGGILSDSKGINVPGSDLSIPALSEKDIQDLA
LGAELGVDWVAVSFVRTRDDLLLARHYLARHGSRARLMAKIEKPSAVYRFEEILEEADGI
MVARGDLGVEMPLEEVPIMQKRLILKAIAAGKPVITATQMLESMVQNPSPTRAEASDVAN
AIFDGTDAVMLSAETAAGAYPVEAVATMARIARVVESSPEFLQKLNVLRPAPTPTTQDAI
AQAADDIVEAVDARAIVVFTATGSSARRIARTRPKVPILALTPNPEVERQLALVWGVLPH
LAPDPQDTDDMVRIALEKAKACGLAQVGERVVIAAGVPFGVRGTTNLIRVERVS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggccttttaagcgcaccaagattgtggccaccctggggcccgcttcggactccaag
gaagccatccgggccctggcggaggcaggggcggatgtctttcgcctgaactttagccac
ggcacccacgaggagcaccgcaggcgggcggcctgggtgcgggaggtggagaaggaactg
ggcaaaaccctggccatcctccaggacctccagggccccaagatccgcataggccgcttc
aaggagggccgggtggagcttaaggccggccagccctttatcctcacccgggctcccgtg
gagggggacgagacccgggtttccatcacctacaaggggcttcccgaggacgtggctccc
ggtcaggtgctcctcttggacgacggccgcctgcgccttcgggtggagaggatccaaggg
gacgagatccacaccgtggtggagctgggtgggattctttccgacagtaaggggatcaac
gtccctggctcggatctttccatccccgctctctcggaaaaggacatccaggacctagcc
ctgggggcggagctcggggtggactgggtggcggtttccttcgtgcgcacccgggatgac
ctgctcctggcccggcactacctggcccggcatggttcccgggcccggctcatggccaag
atagagaagccttccgccgtctaccgctttgaggagatcctggaagaggccgacggcatc
atggtggcccggggggacctgggggtggagatgcctctggaggaggtgcccatcatgcaa
aagcgccttatcctcaaggccattgccgccgggaaaccggtgatcaccgccacccagatg
ctggagtccatggtgcagaacccaagccccacccgggcagaggcctcggatgtggccaac
gccatcttcgacggcacggatgcggtgatgctttccgcggaaaccgctgccggggcctat
ccggtggaggccgtggccaccatggccaggatcgcccgggtggtggagtcctcccccgag
ttcttgcaaaagctcaatgtcctccgcccggctcccacccccaccacccaggacgccatc
gcccaggcggcggacgacatcgtggaggcagtggacgccagggccatcgtggtcttcacc
gccacggggagttccgccaggcgtattgcccgcacgcggcccaaagtgcccatcctggcc
ctcaccccgaaccccgaggtggagcggcagctggccttggtctggggtgttctgccccat
ctggcccccgacccccaggacaccgacgacatggtgcgcatcgccctggagaaggccaag
gcctgcgggctggcccaggtgggggagagggtggtgatcgccgcgggagtgccctttggg
gtgcgggggaccaccaacctcatccgggtggagcgggtgagctaa

DBGET integrated database retrieval system