KEGG   Thiohalobacter thiocyanaticus: FOKN1_2444Help
Entry
FOKN1_2444        CDS       T05229                                 

Definition
(GenBank) acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Organism
ttc  Thiohalobacter thiocyanaticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2591487..2594294
Genome map
AA seq 935 aa AA seqDB search
MTESDTDIARRFLALVQQLVEETQPGRRPPRVDWDSSLDTLGLDSLGRLELLLRIERDLK
LPIDQDRALPLETPRQWLELLGRTPPPAAAAAPAATANREVRIASLPVSADSLGAVLAHH
AEHHGERTHLSFYASEDQVTHLSYTRLFSRARQVAGHLRRIPVEPGDRVALMLPSGVDFF
ECFYAVLLAGAVPVPLYPPASRARILEFMQRQVSILTNAGARLLITDDQVAPFAERLQQQ
VESLQAVHTPEHYRAAAPEHFLPGGGADLALLQYTSGSTGTPKGVMLSHANLLANVRAMG
EASAATADDVFVSWLPLYHDMGLIGACLGSLYHGIPLVLMSPLSFIARPIRWLQLIDRHG
GTLSAAPNFAYQLCASRLQDADLEGLDLSSWRLAFNGAEPVHAGTLEDFITRFEPLGFRR
QAMTPVYGLAENAVGLAFPPLERGPRIDHIDRERLATTNRADAVAADQPQALAVVSGGRA
LPDHAIRVVDEQDQPLPERVQGQIQFRGPSASAGYYRNPEATAGLCRGDWRNTGDFGYLA
DAEIFITGRTKDVIIRAGRNLYPYELEQAVGDLEGIRKGSVAVFGANSAEEDTERLVVLA
ETRERDPDTRERLREQIRQLGIDLLETPVDDVVLAPPRSVLKTSSGKIRRRDCRHLYEQG
KLGEGGETGQVERRLKTRLYAGAAMTGLRRLLHHSVDLLYAGWAWSLFGLCALAVGLLVL
VLPSRRLAQRSAHWGARAGLWLAGISLDVRHRERFVRDRALVVVANHASYLDAIVLTAAY
DHPLHFVAKQELARFPLMRHVLRRLGNEFVQRDDVRESIAASERLVRRVQQGNGIVFFPE
GTFTAAPGLLAFKPGAFQIAVDTATPVLPVAIRGTRQILRGDRWFPRRGRVEVHTGEPLA
SAGEGWSAVIALRDRARAVILAQCAEPDLVRDPGM
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtccgacaccgatatcgccagacgcttcctggccctggtccagcagctggtc
gaggaaacccagcccggccgccggccgccgcgggtggactgggacagttcgctggatacg
ctgggcctggacagtctgggccggctggagttgctgctgcggatcgagcgcgacctgaaa
ctgcccatcgatcaggaccgcgccctgccactggaaaccccgcggcagtggctggaactg
ctgggccgcacaccgccgccggcagcggccgccgcgcccgctgccacggccaaccgcgag
gtgcgcatcgcatcgctgccggtgagcgccgacagcctgggcgcggtgctggcccatcac
gccgaacaccacggcgagcgcacccatctcagtttctacgccagtgaagaccaggtcacg
cacctgagctacacccggctgttcagccgcgcccggcaggtcgccggccacctgcgccgc
atcccggtggagccgggcgaccgcgtcgccctgatgctgccctcgggcgtcgacttcttc
gaatgcttctacgccgtcctgctggccggggccgtgccggtgccgctgtacccgccggcc
agccgcgcccgcatcctggagttcatgcagcgccaggtcagtatcctgaccaacgccggc
gcccggctgctgatcaccgatgaccaggtcgcgcccttcgccgagcggctgcagcagcag
gttgaatccctgcaggcggtgcatacgcccgagcactaccgcgcggccgcgcccgaacat
ttcctgcccggcggcggcgcggacctggccctgctgcagtacacctccggcagcaccggc
acccccaagggggtgatgctcagccacgccaacctgctggccaatgtacgtgccatgggc
gaggccagcgcggccacggccgacgatgtgtttgtgagttggctgccgctgtatcacgac
atgggcctgatcggcgcctgcctgggttcgctctatcacggcatcccgctggtgctgatg
tcgcccctgtcgttcatcgccaggccgatccgctggctgcaactcattgaccgtcacggc
gggaccctgtcggccgcacccaacttcgcctaccagctgtgcgcctcgcgactgcaggat
gccgacctcgagggcctggacctgtccagctggcggctggccttcaacggtgccgagccg
gtgcatgccggcaccctggaggatttcataacacggtttgaaccgctcggattccggcgt
caggccatgaccccggtctacggtctggccgagaacgccgtgggactcgccttcccgccg
ctggagcgcggcccgcgcatcgatcacatcgaccgcgaacgcctggcaaccacgaatcgc
gccgacgcagtcgccgccgaccagccacaggccctggccgtggtcagcggcggacgggcc
ctgcccgaccacgccatccgggtggtggatgagcaggatcagccgctgcccgagcgggtg
cagggacagatccagttccgcggcccctccgccagcgccggctattaccgcaatcccgag
gccacagccggactgtgccgcggcgactggcgcaacaccggcgacttcggctacctggcc
gatgccgagatcttcatcaccggccgcaccaaggacgtgatcatccgcgccggacgcaac
ctctatccctatgaactggaacaggccgtgggcgacctggagggcatccgcaagggctcg
gtggccgtgttcggcgccaactccgcggaggaggataccgaacgcctggtggtgctggcc
gagacccgcgagcgcgacccggacacccgagagcgactgcgtgaacagatccgccaactc
ggcatcgacctgctggagacgccggtcgacgacgtggttctggccccgccgcgcagcgtg
ctcaagacctccagcggcaagatccgccgccgcgactgccgtcacctctacgagcagggg
aaactgggcgagggcggcgagaccggacaggtggaaaggcggcttaaaaccaggttatat
gccggggccgcgatgaccgggctgcggcgcctgctccaccacagcgtcgacctcctctat
gccggctgggcctggagcctgttcggcctgtgcgccctggcggtcgggctgctggtactg
gtcctgccgagccgacgcctggcgcagcgcagcgcccactggggggcccgggccggcctg
tggctggccggcatcagcctggacgtcaggcaccgggaacgcttcgtgcgcgaccgcgcc
ctggtggtggtcgccaaccatgccagctacctggatgccatcgtgctgaccgccgcctac
gaccacccactgcacttcgtcgccaagcaggaactggcccgctttccgctgatgcggcat
gtactgcgcaggctcggcaacgagttcgtgcagcgggacgacgtcagggagagcatcgcc
gccagtgaacggctggtacggcgggtgcagcagggcaacggcatcgtgttcttccccgag
ggcaccttcaccgccgccccgggcctgctcgccttcaagccgggcgccttccagatcgcg
gtggacaccgccaccccggtgctgccggtggccatccgcggcacccggcagatcctgcgc
ggcgaccgctggttcccgcgccgcggccgggtggaagtccataccggcgagccgctcgcg
tccgcgggcgaaggctggagcgcggtcatcgcgctgcgcgaccgggcgcgggcggtgatc
ctggcgcagtgcgcggaaccggatctggtccgggacccgggtatgtga

DBGET integrated database retrieval system