KEGG   Thermococcus thioreducens: A3L14_09170Help
Entry
A3L14_09170       CDS       T05104                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ttd  Thermococcus thioreducens
Pathway
ttd00630  Glyoxylate and dicarboxylate metabolism
ttd01100  Metabolic pathways
ttd01120  Microbial metabolism in diverse environments
ttd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L14_09170
Enzymes [BR:ttd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L14_09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ASJ13044
UniProt: A0A0Q2RFW6
LinkDB All DBs
Position
complement(1661838..1663172)
Genome map
AA seq 444 aa AA seqDB search
MSERFDKIYDYYVDKGYEPNKKRDIIAVFRITPAEGYSIEAVAGGVAAESSTGTWTTLYN
WYEEERWADLSAKAYDFHDMGDGSWIVKIAYPFHAFEEANLPGLLASIAGNVFGMRRAKA
LRLEDMYLPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLATEL
LLNGADYMKDDENLTSPWYNRFEERAEIIAKIIDKVENETGEKKTWFANITANLPEMEER
LEILADLGLKHAMVDVVITGWGALQYIRDLAADYGLAIHGHRAMHATFTRNPYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARIFRESHYKPDEDDVFHLEQKFYGIK
AGFPTSSGGLHPGNLPIVFDALGTDLVIQLGGGTLGHPDGPAAGARAVRQAIDAYMQGIP
LEEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagattcgacaagatatatgactactacgtggacaagggctatgagcccaac
aagaagagggacatcatagccgtgttccgcataacccctgcggagggatacagcatagag
gctgttgctggcggtgttgccgctgagagctcaaccggaacctggacgacgctctacaac
tggtacgaggaggagcgctgggctgatctctctgccaaggcctatgacttccatgacatg
ggcgacggcagctggatagtgaaaatagcctaccctttccatgcctttgaagaggccaac
ctccccgggcttctggccagcatagccggaaacgtcttcggcatgagacgcgctaaagcg
ctccggcttgaggacatgtaccttccggagaagctcatcagggagttcgacggccctgca
ttcggtatcgagggcgtcagaaagatgcttgaaataaaggacaggccaatctacggtgtc
gttccaaagccgaaggtcggctactcgccggaagagttcgagaaacttgccaccgagctg
ctcctcaacggagctgactacatgaaggacgacgagaaccttaccagcccctggtacaac
cgcttcgaggagagggccgagataatagccaaaataatcgacaaggtcgagaacgagacc
ggcgaaaagaagacttggttcgccaacataaccgccaacctcccggagatggaggagagg
cttgaaatcttagcggatcttggactgaagcacgcgatggttgacgttgtcataacgggc
tggggagcactgcagtacatccgtgatttggcagccgactatggattagctattcacggc
cacagggcaatgcatgcgacctttacaaggaacccctaccacggtatctcaatgttcgtt
ctggccaagctctacaggctcataggtatcgaccagctccacgtcggaacggcgggagcc
ggcaagctcgaaggaggaaagtgggacgtcatccagaacgcgaggatattcagggagagc
cactacaagccggacgaggacgatgtcttccacctcgagcagaagttctatggcataaaa
gccggatttccaactagctctggtggactgcaccccggaaacctcccaatagtcttcgat
gccctcggaaccgacctcgtcatacagctcggcggtggaacccttggacacccggacgga
ccggccgctggagcgagggccgtcaggcaggccatagatgcctacatgcagggaattcct
ttggaggaatacgccaagacccacaaggagctcgccagggccctcgaaaagtggggccac
gtcacccctgtctga

DBGET integrated database retrieval system