KEGG   Thermococcus thioreducens: A3L14_10710Help
Entry
A3L14_10710       CDS       T05104                                 

Definition
(GenBank) FAD/NAD(P)-binding oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ttd  Thermococcus thioreducens
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A3L14_10710
Enzymes [BR:ttd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A3L14_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1933513..1935012
Genome map
AA seq 499 aa AA seqDB search
MKTRIAIIGAGVVGASIARVLSQYEGVEVHLIERNVDAGMGVSKANTGIIHPGHEDDPEK
HPLRAKLCVEGNRLWYQWTKELRIPAKWPGELMVALKEEDMKVAEYYLELAQKNGVPGVR
LVDREELLKLEPNVNPNAAGALWAPTAGVMSSPMAAVALTENAVDNGVRFHPETEVRGIK
VENGEIKGVETNRGFIEADLVINAAGLYADRISAMAGIDYFTIRPRKGEYYIFDDDAGPK
VRRIVHQTPTPTTKGVYVITEMNDGVMIGPTAEDLPEEAKDDTSTTREGLEFVWEMAKKL
VKGLPPKSRVIRTFAGLRPEPPDGRWIIEAYDDPWGFINVAGIRSPGLTAAPAIAHYVTE
ELIEGKLDVKLTKKSRWNPHRNAFWFKALPREKQAELVKENPSHGRVICMCRTITEGDIL
DAIARMKKMGVRTITLDGVKLRTGVTGGTCQGSFCRVRITNIIARETGVPLWEVSIKGEG
TEYGIGDIKVLLRGEENEE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacggatcgcaataatcggtgccggcgtcgtaggggcgtcgatagcgcgcgtt
ctcagccagtacgagggagttgaggtccatctaatcgagagaaacgtcgacgcggggatg
ggagtcagcaaggcgaacacgggcataatccatcccggacacgaggacgatcccgaaaag
cacccactgagggcaaagctctgcgtcgagggaaacaggctctggtaccagtggacgaaa
gagctgagaattccagcgaagtggccgggcgagctcatggtcgcactcaaagaggaagac
atgaaggtcgccgagtactacctggagcttgcgcagaaaaacggcgttccgggcgtcagg
ctcgttgatagggaggagcttctgaaacttgagcccaacgtcaacccaaacgccgcaggg
gcgctgtgggcaccgacagctggagtgatgtcctccccgatggcggccgtggcactcacc
gagaacgcggtcgacaacggagttaggttccaccccgaaaccgaggtgcgcgggataaag
gttgagaacggggagataaagggcgttgagactaaccgggggttcatcgaggccgacctc
gtcataaacgcggcaggtttatacgcggacagaatctcggccatggcgggcatagattac
ttcacaatacgtcccaggaagggagagtactacatcttcgacgacgatgccgggccgaag
gtcaggaggatagtccaccagacgccgaccccgaccacaaaaggggtttacgtcatcacc
gagatgaacgacggggtgatgataggacccaccgccgaggatctgcccgaggaagctaag
gacgacacctccacaacccgggaggggctggagttcgtctgggagatggcgaagaagctc
gtcaagggactgccccccaagagcagggtgataagaaccttcgcgggtctgaggccagag
cccccggacggcaggtggataatagaggcctacgatgacccctggggcttcataaacgtt
gcagggataaggtcgcccggactcacagccgcgcctgcaatagcacactacgttactgaa
gagctgattgaaggcaagctggacgtaaagctaaccaaaaagtcccgctggaacccccac
aggaacgccttctggttcaaggccctcccaagggaaaagcaggcagagctcgtgaaggag
aacccctcacacggcagggtaatctgcatgtgccgcacgataacggagggggatatactc
gacgcaatagccaggatgaagaagatgggcgtcaggacgataaccctcgacggcgttaag
ctcaggacaggtgtcactggcggaacctgtcagggttccttctgcagggtgaggataacc
aacatcatcgccagggaaaccggagtcccgctctgggaggtcagcatcaagggagaaggc
accgaatacggcatcggtgacataaaggttctcctgaggggtgaggagaatgaggagtga

DBGET integrated database retrieval system