KEGG   Thermoanaerobacter tengcongensis: TTE1207Help
Entry
TTE1207           CDS       T00081                                 

Gene name
Alr
Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TTE1207 (Alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TTE1207 (Alr)
Enzymes [BR:tte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TTE1207 (Alr)
Peptidoglycan biosynthesis and degradation proteins [BR:tte01011]
 Precursor biosynthesis
  Racemase
   TTE1207 (Alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1207235..1208401
Genome map
AA seq 388 aa AA seqDB search
MKFDGVRPTRVEVYLDAITHNFREIKKIVGKNVKIMAVIKGDAYGHGASYVAKFLEKEGV
DYFGVATTEEALELREKGIKTPILIFGYTPPTQLRQIVKHDLTQTVYDIKYAKELEKESL
KQNKRAKVHIKIDTGLGRIGYIDFDLAQKEILEMANMRGLILEGIYSHFAAASEDDRDYC
KEQFDKFMNLISSLEKKRLKIPLKHIANAAAILNLNYSHLDMVRPGIILFGAYPSKRVER
KVELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKRKSVIATIPVGYADGLDRRLSNNYK
LLLKGKYVPIVGRVCMDQCMIDVTDVEGVEIGDEVVIIGTQNNETVSVESMADKIETIPQ
EVFSRISRRVPRVYFYDGIKIGEVNYLK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgacggggtaagacccacccgcgtagaagtatatctagatgcaataacacat
aacttcagagaaataaagaagatagttggaaaaaatgtgaaaataatggcggtgataaaa
ggggatgcatatggtcatggagcttcatatgtagccaaatttttagaaaaagaaggggta
gactatttcggagtagcaactacagaagaagctttagagttgagggaaaagggaataaaa
actcctattctaatttttggttatactcctcctacacagttaagacaaatagttaaacat
gaccttactcaaacggtgtacgatataaaatatgcgaaagagttagagaaagaaagtcta
aaacaaaacaaaagagcaaaagtccatataaaaattgatacaggtttgggacgaatcgga
tatattgattttgatttagcgcagaaagagattctagaaatggcaaacatgagaggatta
atattggaagggatatacagtcattttgctgccgcatccgaagatgatagggattattgc
aaagagcagttcgacaaattcatgaatctaattagtagtttggagaaaaaaaggttaaaa
attcctttaaaacatatagccaatgcggcagctattttaaatctcaattattctcattta
gatatggtaaggccgggtataattttgttcggtgcatatccttcaaagagagtagaacga
aaggtagaattgagagaaacactgaggtttactacgcgggtggtccatttaaaagatgta
ccagcgggattttttataggctacggcaaaagttttgtgacaaaaagaaaaagtgtaata
gctactatccccgtggggtatgcggatggacttgataggagattatctaataactataaa
ttgctattaaagggaaagtatgttccaatagtaggcagagtatgtatggaccagtgcatg
atagatgttactgatgtagaaggtgtggaaataggagatgaggtggttattatagggaca
caaaacaatgagacagtttctgtagaatctatggctgataaaattgaaactattcctcaa
gaagttttttctagaattagcagaagggtgcctagagtgtatttttatgatggaataaag
attggagaagtaaattacttaaagtga

DBGET integrated database retrieval system