KEGG   Thermoanaerobacter tengcongensis: TTE2001Help
Entry
TTE2001           CDS       T00081                                 

Definition
(GenBank) predicted dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TTE2001
Enzymes [BR:tte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TTE2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1949575..1951071)
Genome map
AA seq 498 aa AA seqDB search
MVYDVLIVGAGVVGCSIARELSKYKLKVIVVEKGEDAASEGASKANSAILHAGYDPVPGT
LKAKLNVRGNEMFEELCKDLDVPMKRTGSLVVAFSEEEIKELYKLFDRGIKNGVKELSII
TKDMVKEIEPYINDNVIAALYAKKAGIISPYVFTIALAENAAQNGVEFSFNSEVVDIKRK
EDVFVVKTPSKEFYARYVVNAAGVYSDVINNMVGAKPFSVHPRKGEYLILDKDQGYIART
VIFQVPTKMGKGILVSPTIDGNLLIGPTSEDIQDKEFKATTREGLNKAITVAKRSVDKFD
VRKTITQFTGLRATPDTEEKDFIIGESDVKGFINVAGIESPGFTAAPAIAEMVRDILKDA
GLELVEKDDFNPKRKPVIRFVELSDEEKNRLIKENPAYGRIVCRCETVTEGEVIDAIRRP
VGAKSVDGVKRRVRAGMGRCQGSFCGPRIVEILARELNISPLEVTKHGRNSYILAGETKK
FLLDKASELLKKEVYGNA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacgatgttttaatagtaggtgccggtgtggtaggatgctctattgcaagagag
ctttctaaatataaattaaaagtgattgtggtggaaaaaggagaagacgcagcttcagaa
ggggcatcaaaagctaacagcgcaatacttcacgcagggtatgacccggttccagggact
ttgaaagcaaagctcaatgtccgtgggaatgaaatgtttgaagaactgtgcaaagacctg
gacgttcctatgaaaaggactggttctttagtggtggctttttcagaagaggaaattaaa
gagctttacaagctatttgacagaggcataaagaatggagtaaaagagctctccataatt
acaaaggacatggtaaaggaaattgaaccgtatataaatgacaatgtcatagctgctcta
tacgccaaaaaggctggaattatttctccttatgttttcactattgctctggcggaaaat
gctgcccaaaacggggtagagttttcttttaattcggaggtagtagatattaagagaaag
gaggatgtatttgtcgtaaagacgccttcaaaggagttttatgcaaggtatgtggtcaat
gcagctggagtttattctgatgtgataaacaatatggtgggagcaaaacctttctctgtg
catccaagaaaaggtgagtatctgatacttgacaaagatcaaggctatattgccaggact
gtgatattccaggtgccgacaaagatgggaaaaggtattctggtatcacccaccattgac
ggcaatttgcttataggacctacttcagaagacatacaggataaggaatttaaagcgact
acgagggaaggacttaataaagccattactgttgctaaaagaagtgtggataaatttgac
gttcgaaagacaataacgcagtttacaggtttaagagctactcctgacacggaggagaag
gattttatcataggagaatcggatgtgaaaggatttataaatgtggctggaatagaatcc
cctggttttacagcagcacctgcaattgcggaaatggtgagagatatattaaaagacgca
ggtcttgagcttgttgaaaaggacgattttaacccaaagaggaaacctgttataaggttt
gtagagctttctgatgaagagaaaaataggctcattaaagaaaatcctgcctatggaagg
atagtatgcaggtgtgagacggtgacagaaggagaagttatagatgcaataagaagacct
gttggagcgaaatcggtggacggggtaaaaaggcgcgtaagagcaggcatgggcaggtgt
cagggaagtttctgtggtcccaggatagtagagatacttgcaagagagcttaacatttct
cctcttgaagttacaaagcatggcaggaattcttacattcttgccggtgagacaaagaag
tttttattagacaaggcttcagagcttttgaagaaagaggtgtatggcaatgcttaa

DBGET integrated database retrieval system