KEGG   Thermogutta terrifontis: THTE_2055Help
Entry
THTE_2055         CDS       T05034                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ttf  Thermogutta terrifontis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ttf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    THTE_2055
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    THTE_2055
Enzymes [BR:ttf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     THTE_2055
Bacterial toxins [BR:ttf02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   THTE_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2111644..2112819)
Genome map
AA seq 391 aa AA seqDB search
MKTWLTLTGIIPFCASVRKTRVHTVIIPILWGVILFGPCRAPANEPGLQHVTVFTSGEGG
YHTIRIPALEVAPNGTLLAFAEGRRNSSADPGWPGQEIDLLLKTSRDGGRTWSPIRVIEH
SGAQWSSANPATVVDKTTGRIWLFYLRCAPGANTHRARPGSRDVLNLVRFSDDHGEHWSD
PVDLTPVARDMADKEWGTSVPGPGGGIQLSSGRLVIPMWRYRPFRDFVLFSDDHGATWQR
GGFVPGEMGVDECQLVELADGRLALDMRQQNGPHRWVSFSRDGGQTWSEPRPGQEVTPVC
CAVERWTSVKRGDDRNRIAWTGPRGPGRNNLTLWISYDELQTFQNPRLISEGPGAYSDLA
VLPDKTLGILWEKAYQEIIFAAVSLSWVEPR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctggttgacgctcacagggattattcctttttgcgcatctgtgcggaagaca
cgcgtgcacacggttattattccgatcctgtggggcgtgatcttgtttgggccatgtcgt
gcaccggccaatgaacctggcttacagcatgtgacggtgtttacgtccggagaaggaggt
taccacacgatcaggattcccgctctggaggtcgctcccaacggtacactcctggctttt
gccgaaggccgtcgcaacagcagtgctgaccccggctggcctggccaggagattgactta
ctgttgaaaaccagtcgcgacgggggccgcacctggtcgccgatacgtgtgattgaacat
tcgggcgcccagtggtcctctgccaatcctgccacggtggtcgacaaaaccacggggcga
atctggcttttttaccttcgctgcgcgccgggagccaatacccaccgtgcccgcccgggt
tcacgcgatgtcctcaatctcgtccgattcagcgacgaccacggggaacactggtccgat
cctgtcgatttgacgccggtggctagggatatggcggacaaggaatggggcacgagcgtc
ccagggccggggggtgggattcaactgtcatcggggaggctcgtcatcccaatgtggcgt
taccgtcctttccgggattttgtcctcttcagtgacgaccatggggcaacctggcagaga
ggcggatttgtccccggtgaaatgggggtggacgagtgccagctcgtggaattggctgac
ggcaggcttgccctggatatgcggcagcagaatggtccccaccgttgggttagcttcagt
cgcgatggtggccaaacctggtcagagccacggcctggccaggaggttactcccgtgtgc
tgtgccgtggaacggtggacctcggtgaaaaggggggatgatcgcaatcgcattgcctgg
acgggtccacgcggtcctgggcgaaataacctcacgctttggattagctatgacgaactg
caaacgtttcaaaatccacgtctgataagcgaaggacccggggcctactccgacctggcg
gtcctccccgataagaccctcggcatcttatgggagaaagcgtaccaggagatcattttt
gccgcggtctccctgtcatgggtggagccgcgatga

DBGET integrated database retrieval system