KEGG   Thermus thermophilus HB27: TT_C0168Help
Entry
TT_C0168          CDS       T00170                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
tth  Thermus thermophilus HB27
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TT_C0168
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TT_C0168
   00620 Pyruvate metabolism
    TT_C0168
   00630 Glyoxylate and dicarboxylate metabolism
    TT_C0168
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TT_C0168
   00680 Methane metabolism
    TT_C0168
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TT_C0168
Enzymes [BR:tth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TT_C0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(149072..150055)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDC
AFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRR
MTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGAYRVVEGLEIN
EFARKRMEITAQELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacccgtacgcgtggcggttaccggagccgcgggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagccggtgatcctccagctt
ttggagatcccccaggccatgaaggccctggaaggcgtggtcatggagctggaggactgc
gccttccccctgcttgcgggcctcgaggccaccgacgaccccaaggtggccttcaaggac
gccgactacgccctcctggtgggggcggccccccgcaaggcggggatggagcgccgggac
cttctgcaggtaaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagaaggacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctcgccaagaagaccgggacgggcgtggaccgcatccgccgc
atgacggtgtggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacggcaggcccgccctggagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggccagcagcgccgccagc
gccgcgaacgccgccatagagcacatccgcgactgggccctgggcaccccggagggggac
tgggtctccatggccgtcccctcccaaggggagtacggcatccccgaaggcatcgtctac
tccttcccggtgacagccaaggacggagcgtaccgggtcgtggaaggcctggagatcaac
gagttcgcccgcaagcgcatggagatcacggcccaggaactcctggacgagatggagcag
gtgaaggccctgggcctcatctga

DBGET integrated database retrieval system